Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 270307..270955 | Replicon | chromosome |
| Accession | NZ_CP104288 | ||
| Organism | Stenotrophomonas maltophilia strain ACYCa.2H | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | K7568_RS01205 | Protein ID | WP_005407702.1 |
| Coordinates | 270307..270612 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | K7568_RS01210 | Protein ID | WP_227860157.1 |
| Coordinates | 270653..270955 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K7568_RS01175 (K7568_01175) | 266261..267052 | - | 792 | WP_165931275.1 | zinc-dependent peptidase | - |
| K7568_RS01180 (K7568_01180) | 267019..267297 | - | 279 | WP_005407696.1 | hypothetical protein | - |
| K7568_RS01185 (K7568_01185) | 267442..268407 | + | 966 | WP_043035430.1 | bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA | - |
| K7568_RS01190 (K7568_01190) | 268404..269135 | + | 732 | WP_005407698.1 | type III pantothenate kinase | - |
| K7568_RS01195 (K7568_01195) | 269145..269999 | + | 855 | WP_005411958.1 | SPOR domain-containing protein | - |
| K7568_RS01205 (K7568_01205) | 270307..270612 | + | 306 | WP_005407702.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| K7568_RS01210 (K7568_01210) | 270653..270955 | + | 303 | WP_227860157.1 | putative addiction module antidote protein | Antitoxin |
| K7568_RS01215 (K7568_01215) | 271213..271512 | - | 300 | WP_005407704.1 | hypothetical protein | - |
| K7568_RS01220 (K7568_01220) | 271593..272000 | - | 408 | WP_043035194.1 | hypothetical protein | - |
| K7568_RS01225 (K7568_01225) | 272595..273365 | + | 771 | WP_005411960.1 | DUF3011 domain-containing protein | - |
| K7568_RS01230 (K7568_01230) | 273390..273737 | - | 348 | WP_005411961.1 | hypothetical protein | - |
| K7568_RS01235 (K7568_01235) | 273868..274788 | + | 921 | WP_005407709.1 | arginase | - |
| K7568_RS01240 (K7568_01240) | 274949..275086 | + | 138 | WP_005407710.1 | entericidin A/B family lipoprotein | - |
| K7568_RS01245 (K7568_01245) | 275295..275516 | + | 222 | WP_004153772.1 | CsbD family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11444.15 Da Isoelectric Point: 10.9897
>T257490 WP_005407702.1 NZ_CP104288:270307-270612 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|