Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 272345..272993 | Replicon | chromosome |
Accession | NZ_CP104287 | ||
Organism | Stenotrophomonas maltophilia strain ACYCb.1K |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | K7567_RS01190 | Protein ID | WP_111097688.1 |
Coordinates | 272345..272632 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A0U5HHQ5 |
Locus tag | K7567_RS01195 | Protein ID | WP_058979789.1 |
Coordinates | 272691..272993 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K7567_RS01160 (K7567_01160) | 268287..269078 | - | 792 | WP_206621621.1 | zinc-dependent peptidase | - |
K7567_RS01165 (K7567_01165) | 269045..269323 | - | 279 | WP_005411956.1 | hypothetical protein | - |
K7567_RS01170 (K7567_01170) | 269468..270436 | + | 969 | WP_227854337.1 | bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA | - |
K7567_RS01175 (K7567_01175) | 270433..271164 | + | 732 | WP_019661840.1 | type III pantothenate kinase | - |
K7567_RS01180 (K7567_01180) | 271174..272022 | + | 849 | WP_227854336.1 | SPOR domain-containing protein | - |
K7567_RS01190 (K7567_01190) | 272345..272632 | + | 288 | WP_111097688.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K7567_RS01195 (K7567_01195) | 272691..272993 | + | 303 | WP_058979789.1 | putative addiction module antidote protein | Antitoxin |
K7567_RS01200 (K7567_01200) | 273051..273374 | - | 324 | WP_062606011.1 | hypothetical protein | - |
K7567_RS01205 (K7567_01205) | 273455..273862 | - | 408 | WP_134729679.1 | hypothetical protein | - |
K7567_RS01210 (K7567_01210) | 274459..275229 | + | 771 | WP_188250544.1 | DUF3011 domain-containing protein | - |
K7567_RS01215 (K7567_01215) | 275254..275601 | - | 348 | WP_057503835.1 | hypothetical protein | - |
K7567_RS01220 (K7567_01220) | 275733..276653 | + | 921 | WP_227854335.1 | arginase | - |
K7567_RS01225 (K7567_01225) | 276816..276953 | + | 138 | WP_019661832.1 | entericidin A/B family lipoprotein | - |
K7567_RS01230 (K7567_01230) | 277156..277377 | + | 222 | WP_019661831.1 | CsbD family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10804.44 Da Isoelectric Point: 11.3617
>T257488 WP_111097688.1 NZ_CP104287:272345-272632 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRRLGDGISELRIDAGPGYRLYYTQRGRQLLILLVGGDKSS
QHRDIEKAREIARAL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRRLGDGISELRIDAGPGYRLYYTQRGRQLLILLVGGDKSS
QHRDIEKAREIARAL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|