Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4570185..4570792 | Replicon | chromosome |
Accession | NZ_CP104285 | ||
Organism | Enterobacter mori strain JT.W3M11 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7H0N5B9 |
Locus tag | N2K86_RS21625 | Protein ID | WP_071993467.1 |
Coordinates | 4570607..4570792 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N2K86_RS21620 | Protein ID | WP_260659923.1 |
Coordinates | 4570185..4570592 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2K86_RS21605 (N2K86_21605) | 4565539..4566939 | + | 1401 | WP_260659920.1 | MFS transporter | - |
N2K86_RS21610 (N2K86_21610) | 4566950..4568899 | + | 1950 | WP_260659921.1 | glycoside hydrolase family 127 protein | - |
N2K86_RS21615 (N2K86_21615) | 4569105..4570181 | + | 1077 | WP_260659922.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
N2K86_RS21620 (N2K86_21620) | 4570185..4570592 | - | 408 | WP_260659923.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N2K86_RS21625 (N2K86_21625) | 4570607..4570792 | - | 186 | WP_071993467.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N2K86_RS21630 (N2K86_21630) | 4571002..4571742 | - | 741 | WP_260659924.1 | MipA/OmpV family protein | - |
N2K86_RS21635 (N2K86_21635) | 4571860..4572825 | + | 966 | WP_260659925.1 | LysR family transcriptional regulator | - |
N2K86_RS21640 (N2K86_21640) | 4572822..4574360 | - | 1539 | WP_260659926.1 | aldehyde dehydrogenase family protein | - |
N2K86_RS21645 (N2K86_21645) | 4574526..4575410 | + | 885 | WP_260659927.1 | ROK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6882.06 Da Isoelectric Point: 11.2341
>T257485 WP_071993467.1 NZ_CP104285:c4570792-4570607 [Enterobacter mori]
VKSADVITVLISHGWKCVRTKGSHHQFRHPEQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADVITVLISHGWKCVRTKGSHHQFRHPEQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15025.73 Da Isoelectric Point: 4.3197
>AT257485 WP_260659923.1 NZ_CP104285:c4570592-4570185 [Enterobacter mori]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTSHFEALFELDDALPLPGNVEAHLESRPEDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSYVSEHPQFGNRSAFLAEAARRVLPG
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTSHFEALFELDDALPLPGNVEAHLESRPEDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSYVSEHPQFGNRSAFLAEAARRVLPG
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|