Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3802044..3802701 | Replicon | chromosome |
Accession | NZ_CP104285 | ||
Organism | Enterobacter mori strain JT.W3M11 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A6S5Y1H5 |
Locus tag | N2K86_RS17905 | Protein ID | WP_010435320.1 |
Coordinates | 3802044..3802454 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V3PWU7 |
Locus tag | N2K86_RS17910 | Protein ID | WP_010435322.1 |
Coordinates | 3802435..3802701 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2K86_RS17885 (N2K86_17885) | 3798036..3799769 | - | 1734 | WP_260659500.1 | single-stranded-DNA-specific exonuclease RecJ | - |
N2K86_RS17890 (N2K86_17890) | 3799775..3800488 | - | 714 | WP_260659501.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N2K86_RS17895 (N2K86_17895) | 3800517..3801413 | - | 897 | WP_089600303.1 | site-specific tyrosine recombinase XerD | - |
N2K86_RS17900 (N2K86_17900) | 3801515..3802036 | + | 522 | WP_260659502.1 | flavodoxin FldB | - |
N2K86_RS17905 (N2K86_17905) | 3802044..3802454 | - | 411 | WP_010435320.1 | protein YgfX | Toxin |
N2K86_RS17910 (N2K86_17910) | 3802435..3802701 | - | 267 | WP_010435322.1 | FAD assembly factor SdhE | Antitoxin |
N2K86_RS17915 (N2K86_17915) | 3802996..3803976 | + | 981 | WP_260659503.1 | tRNA-modifying protein YgfZ | - |
N2K86_RS17920 (N2K86_17920) | 3804055..3805188 | - | 1134 | WP_260659428.1 | integrase core domain-containing protein | - |
N2K86_RS17925 (N2K86_17925) | 3805385..3806044 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
N2K86_RS17930 (N2K86_17930) | 3806311..3807042 | + | 732 | WP_260661716.1 | MurR/RpiR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16173.06 Da Isoelectric Point: 11.5020
>T257484 WP_010435320.1 NZ_CP104285:c3802454-3802044 [Enterobacter mori]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEIVGTPWMLSVGMMLRLRQPEGGRRQHLWLAADSMDAAEWRDLRRMMLQQPTQD
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEIVGTPWMLSVGMMLRLRQPEGGRRQHLWLAADSMDAAEWRDLRRMMLQQPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6S5Y1H5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PWU7 |