Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2944463..2945053 | Replicon | chromosome |
Accession | NZ_CP104285 | ||
Organism | Enterobacter mori strain JT.W3M11 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | N2K86_RS13960 | Protein ID | WP_260658984.1 |
Coordinates | 2944463..2944795 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | N2K86_RS13965 | Protein ID | WP_260658985.1 |
Coordinates | 2944796..2945053 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2K86_RS13945 (N2K86_13945) | 2940627..2941952 | + | 1326 | WP_260658982.1 | SidA/IucD/PvdA family monooxygenase | - |
N2K86_RS13950 (N2K86_13950) | 2941979..2944168 | + | 2190 | WP_260658983.1 | TonB-dependent siderophore receptor | - |
N2K86_RS13960 (N2K86_13960) | 2944463..2944795 | - | 333 | WP_260658984.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N2K86_RS13965 (N2K86_13965) | 2944796..2945053 | - | 258 | WP_260658985.1 | antitoxin | Antitoxin |
N2K86_RS13970 (N2K86_13970) | 2945319..2946278 | - | 960 | WP_260658986.1 | zinc-binding alcohol dehydrogenase family protein | - |
N2K86_RS13975 (N2K86_13975) | 2946325..2946714 | - | 390 | WP_260658987.1 | RidA family protein | - |
N2K86_RS13980 (N2K86_13980) | 2946856..2947776 | + | 921 | WP_260658988.1 | LysR family transcriptional regulator | - |
N2K86_RS13985 (N2K86_13985) | 2947852..2948154 | - | 303 | WP_260658989.1 | helix-turn-helix domain-containing protein | - |
N2K86_RS13990 (N2K86_13990) | 2948159..2948512 | - | 354 | WP_062935980.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N2K86_RS13995 (N2K86_13995) | 2948732..2949682 | - | 951 | WP_010432106.1 | HTH-type transcriptional regulator Cbl | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11745.68 Da Isoelectric Point: 7.7230
>T257481 WP_260658984.1 NZ_CP104285:c2944795-2944463 [Enterobacter mori]
MDRGEIWLVSLDPIAGHEQSGKCPVLIVSKALFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTKTTGVICCDQPRTI
DMAARNGMRLERIPDAVVNEVLARLDAILN
MDRGEIWLVSLDPIAGHEQSGKCPVLIVSKALFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTKTTGVICCDQPRTI
DMAARNGMRLERIPDAVVNEVLARLDAILN
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|