Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1055719..1056339 | Replicon | chromosome |
Accession | NZ_CP104285 | ||
Organism | Enterobacter mori strain JT.W3M11 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V3PUI7 |
Locus tag | N2K86_RS04990 | Protein ID | WP_010428174.1 |
Coordinates | 1055719..1055937 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | N2K86_RS04995 | Protein ID | WP_008499288.1 |
Coordinates | 1055965..1056339 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2K86_RS04960 (N2K86_04960) | 1051728..1051988 | + | 261 | WP_010428154.1 | type B 50S ribosomal protein L31 | - |
N2K86_RS04965 (N2K86_04965) | 1051991..1052131 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
N2K86_RS04970 (N2K86_04970) | 1052128..1052838 | - | 711 | WP_260660673.1 | GNAT family protein | - |
N2K86_RS04975 (N2K86_04975) | 1052940..1054400 | + | 1461 | WP_260660674.1 | PLP-dependent aminotransferase family protein | - |
N2K86_RS04980 (N2K86_04980) | 1054372..1054839 | - | 468 | WP_042714806.1 | YlaC family protein | - |
N2K86_RS04985 (N2K86_04985) | 1054958..1055509 | - | 552 | WP_260660675.1 | maltose O-acetyltransferase | - |
N2K86_RS04990 (N2K86_04990) | 1055719..1055937 | - | 219 | WP_010428174.1 | HHA domain-containing protein | Toxin |
N2K86_RS04995 (N2K86_04995) | 1055965..1056339 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
N2K86_RS05000 (N2K86_05000) | 1056856..1059993 | - | 3138 | WP_260660676.1 | multidrug efflux RND transporter permease subunit AcrB | - |
N2K86_RS05005 (N2K86_05005) | 1060016..1061209 | - | 1194 | WP_260660677.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8597.97 Da Isoelectric Point: 8.9008
>T257476 WP_010428174.1 NZ_CP104285:c1055937-1055719 [Enterobacter mori]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT257476 WP_008499288.1 NZ_CP104285:c1056339-1055965 [Enterobacter mori]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|