Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 271348..271944 | Replicon | chromosome |
Accession | NZ_CP104285 | ||
Organism | Enterobacter mori strain JT.W3M11 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | N2K86_RS01315 | Protein ID | WP_260660198.1 |
Coordinates | 271642..271944 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | N2K86_RS01310 | Protein ID | WP_041912091.1 |
Coordinates | 271348..271635 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2K86_RS01305 (N2K86_01305) | 269720..271351 | + | 1632 | WP_260660197.1 | Na/Pi cotransporter family protein | - |
N2K86_RS01310 (N2K86_01310) | 271348..271635 | - | 288 | WP_041912091.1 | putative addiction module antidote protein | Antitoxin |
N2K86_RS01315 (N2K86_01315) | 271642..271944 | - | 303 | WP_260660198.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N2K86_RS01320 (N2K86_01320) | 272142..273014 | + | 873 | WP_260660199.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
N2K86_RS01325 (N2K86_01325) | 273015..273287 | - | 273 | WP_014830263.1 | DUF3811 domain-containing protein | - |
N2K86_RS01330 (N2K86_01330) | 273338..274282 | - | 945 | WP_260660200.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
N2K86_RS01335 (N2K86_01335) | 274376..275725 | - | 1350 | WP_260660201.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11443.21 Da Isoelectric Point: 9.7113
>T257475 WP_260660198.1 NZ_CP104285:c271944-271642 [Enterobacter mori]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQSNCIIVLLCGGDKS
SQDRDILMAKMLGNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQSNCIIVLLCGGDKS
SQDRDILMAKMLGNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|