Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 72229..72891 | Replicon | chromosome |
Accession | NZ_CP104285 | ||
Organism | Enterobacter mori strain JT.W3M11 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N2K86_RS00355 | Protein ID | WP_260660082.1 |
Coordinates | 72493..72891 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N2K86_RS00350 | Protein ID | WP_216358243.1 |
Coordinates | 72229..72489 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2K86_RS00325 (N2K86_00325) | 67444..68565 | - | 1122 | WP_260660077.1 | efflux RND transporter periplasmic adaptor subunit | - |
N2K86_RS00330 (N2K86_00330) | 68714..69283 | - | 570 | WP_260660078.1 | TetR/AcrR family transcriptional regulator | - |
N2K86_RS00335 (N2K86_00335) | 69470..69889 | + | 420 | WP_260660079.1 | GNAT family N-acetyltransferase | - |
N2K86_RS00340 (N2K86_00340) | 69886..70533 | - | 648 | WP_260660080.1 | TetR/AcrR family transcriptional regulator | - |
N2K86_RS00345 (N2K86_00345) | 70612..72111 | + | 1500 | WP_260660081.1 | MDR family MFS transporter | - |
N2K86_RS00350 (N2K86_00350) | 72229..72489 | + | 261 | WP_216358243.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N2K86_RS00355 (N2K86_00355) | 72493..72891 | + | 399 | WP_260660082.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N2K86_RS00360 (N2K86_00360) | 73080..73880 | + | 801 | WP_260660083.1 | lipoprotein NlpA | - |
N2K86_RS00365 (N2K86_00365) | 74003..74782 | + | 780 | WP_260660084.1 | MBL fold metallo-hydrolase | - |
N2K86_RS00370 (N2K86_00370) | 74808..75761 | + | 954 | WP_260660085.1 | helix-turn-helix domain-containing protein | - |
N2K86_RS00375 (N2K86_00375) | 75790..76878 | - | 1089 | WP_260660086.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14784.03 Da Isoelectric Point: 6.3267
>T257474 WP_260660082.1 NZ_CP104285:72493-72891 [Enterobacter mori]
MLHMLDTNIVSHLVRQHPEVLNQYSRIAPEKMCISSVTEAELLYGVAKKQNNQLHKTIVEFLKTITICDWDSEAAAAYGE
LRAVMEKKGKVMGDLDQLIAAHAISRGTTIVTNDRAFGMVQDLRIEDWTTAA
MLHMLDTNIVSHLVRQHPEVLNQYSRIAPEKMCISSVTEAELLYGVAKKQNNQLHKTIVEFLKTITICDWDSEAAAAYGE
LRAVMEKKGKVMGDLDQLIAAHAISRGTTIVTNDRAFGMVQDLRIEDWTTAA
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|