Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4341775..4342379 | Replicon | chromosome |
Accession | NZ_CP104284 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii strain JT.WLB1A |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2J0PXG2 |
Locus tag | N2K85_RS20430 | Protein ID | WP_071788668.1 |
Coordinates | 4342194..4342379 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A2G4ZRB5 |
Locus tag | N2K85_RS20425 | Protein ID | WP_023295606.1 |
Coordinates | 4341775..4342179 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2K85_RS20410 (N2K85_20410) | 4337315..4338133 | - | 819 | WP_032649828.1 | helix-turn-helix domain-containing protein | - |
N2K85_RS20415 (N2K85_20415) | 4338359..4339759 | + | 1401 | WP_047062387.1 | MFS transporter | - |
N2K85_RS20420 (N2K85_20420) | 4339770..4341719 | + | 1950 | WP_047062388.1 | glycoside hydrolase family 127 protein | - |
N2K85_RS20425 (N2K85_20425) | 4341775..4342179 | - | 405 | WP_023295606.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N2K85_RS20430 (N2K85_20430) | 4342194..4342379 | - | 186 | WP_071788668.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N2K85_RS20435 (N2K85_20435) | 4342629..4344167 | - | 1539 | WP_006808612.1 | aldehyde dehydrogenase AldB | - |
N2K85_RS20440 (N2K85_20440) | 4344334..4345218 | + | 885 | WP_015572761.1 | ROK family protein | - |
N2K85_RS20445 (N2K85_20445) | 4345222..4347060 | - | 1839 | WP_260673236.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6822.05 Da Isoelectric Point: 11.5191
>T257471 WP_071788668.1 NZ_CP104284:c4342379-4342194 [Enterobacter hormaechei subsp. steigerwaltii]
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14954.71 Da Isoelectric Point: 4.2329
>AT257471 WP_023295606.1 NZ_CP104284:c4342179-4341775 [Enterobacter hormaechei subsp. steigerwaltii]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0PXG2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G4ZRB5 |