Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3669128..3669785 | Replicon | chromosome |
| Accession | NZ_CP104284 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain JT.WLB1A | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A179PSF7 |
| Locus tag | N2K85_RS17190 | Protein ID | WP_017382887.1 |
| Coordinates | 3669128..3669538 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | N2K85_RS17195 | Protein ID | WP_003863437.1 |
| Coordinates | 3669519..3669785 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2K85_RS17170 (N2K85_17170) | 3665126..3666859 | - | 1734 | WP_017382886.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N2K85_RS17175 (N2K85_17175) | 3666865..3667578 | - | 714 | WP_003863443.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N2K85_RS17180 (N2K85_17180) | 3667607..3668503 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| N2K85_RS17185 (N2K85_17185) | 3668605..3669126 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| N2K85_RS17190 (N2K85_17190) | 3669128..3669538 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
| N2K85_RS17195 (N2K85_17195) | 3669519..3669785 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| N2K85_RS17200 (N2K85_17200) | 3670080..3671060 | + | 981 | WP_017692714.1 | tRNA-modifying protein YgfZ | - |
| N2K85_RS17205 (N2K85_17205) | 3671172..3671831 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| N2K85_RS17210 (N2K85_17210) | 3672098..3672829 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
| N2K85_RS17215 (N2K85_17215) | 3672946..3674379 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T257470 WP_017382887.1 NZ_CP104284:c3669538-3669128 [Enterobacter hormaechei subsp. steigerwaltii]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A179PSF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |