Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1075080..1075700 Replicon chromosome
Accession NZ_CP104284
Organism Enterobacter hormaechei subsp. steigerwaltii strain JT.WLB1A

Toxin (Protein)


Gene name Hha Uniprot ID A0A837FFM2
Locus tag N2K85_RS05065 Protein ID WP_015571250.1
Coordinates 1075080..1075298 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID F5RUW7
Locus tag N2K85_RS05070 Protein ID WP_006809850.1
Coordinates 1075326..1075700 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2K85_RS05035 (N2K85_05035) 1071092..1071352 + 261 WP_015571255.1 type B 50S ribosomal protein L31 -
N2K85_RS05040 (N2K85_05040) 1071355..1071495 + 141 WP_003859006.1 type B 50S ribosomal protein L36 -
N2K85_RS05045 (N2K85_05045) 1071492..1072202 - 711 WP_047063250.1 GNAT family protein -
N2K85_RS05050 (N2K85_05050) 1072304..1073764 + 1461 WP_047063252.1 PLP-dependent aminotransferase family protein -
N2K85_RS05055 (N2K85_05055) 1073736..1074203 - 468 WP_023296041.1 YlaC family protein -
N2K85_RS05060 (N2K85_05060) 1074320..1074871 - 552 WP_015571251.1 maltose O-acetyltransferase -
N2K85_RS05065 (N2K85_05065) 1075080..1075298 - 219 WP_015571250.1 HHA domain-containing protein Toxin
N2K85_RS05070 (N2K85_05070) 1075326..1075700 - 375 WP_006809850.1 Hha toxicity modulator TomB Antitoxin
N2K85_RS05075 (N2K85_05075) 1076211..1079357 - 3147 WP_033486650.1 multidrug efflux RND transporter permease subunit AcrB -
N2K85_RS05080 (N2K85_05080) 1079380..1080573 - 1194 WP_017694395.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8583.95 Da        Isoelectric Point: 8.9008

>T257460 WP_015571250.1 NZ_CP104284:c1075298-1075080 [Enterobacter hormaechei subsp. steigerwaltii]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14497.28 Da        Isoelectric Point: 4.8989

>AT257460 WP_006809850.1 NZ_CP104284:c1075700-1075326 [Enterobacter hormaechei subsp. steigerwaltii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837FFM2

Antitoxin

Source ID Structure
AlphaFold DB A0A837FGN8

References