Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1075080..1075700 | Replicon | chromosome |
| Accession | NZ_CP104284 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain JT.WLB1A | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | N2K85_RS05065 | Protein ID | WP_015571250.1 |
| Coordinates | 1075080..1075298 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | N2K85_RS05070 | Protein ID | WP_006809850.1 |
| Coordinates | 1075326..1075700 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2K85_RS05035 (N2K85_05035) | 1071092..1071352 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
| N2K85_RS05040 (N2K85_05040) | 1071355..1071495 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| N2K85_RS05045 (N2K85_05045) | 1071492..1072202 | - | 711 | WP_047063250.1 | GNAT family protein | - |
| N2K85_RS05050 (N2K85_05050) | 1072304..1073764 | + | 1461 | WP_047063252.1 | PLP-dependent aminotransferase family protein | - |
| N2K85_RS05055 (N2K85_05055) | 1073736..1074203 | - | 468 | WP_023296041.1 | YlaC family protein | - |
| N2K85_RS05060 (N2K85_05060) | 1074320..1074871 | - | 552 | WP_015571251.1 | maltose O-acetyltransferase | - |
| N2K85_RS05065 (N2K85_05065) | 1075080..1075298 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
| N2K85_RS05070 (N2K85_05070) | 1075326..1075700 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| N2K85_RS05075 (N2K85_05075) | 1076211..1079357 | - | 3147 | WP_033486650.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| N2K85_RS05080 (N2K85_05080) | 1079380..1080573 | - | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T257460 WP_015571250.1 NZ_CP104284:c1075298-1075080 [Enterobacter hormaechei subsp. steigerwaltii]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT257460 WP_006809850.1 NZ_CP104284:c1075700-1075326 [Enterobacter hormaechei subsp. steigerwaltii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |