Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4200673..4201487 | Replicon | chromosome |
| Accession | NZ_CP104274 | ||
| Organism | Escherichia coli strain Ec15103 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | N2O69_RS20600 | Protein ID | WP_001054376.1 |
| Coordinates | 4200673..4200930 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | S1NWL7 |
| Locus tag | N2O69_RS20605 | Protein ID | WP_001540600.1 |
| Coordinates | 4200942..4201487 (+) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2O69_RS20575 (4195961) | 4195961..4197067 | + | 1107 | WP_001774143.1 | N-acetylneuraminate epimerase | - |
| N2O69_RS20580 (4197132) | 4197132..4198112 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| N2O69_RS20585 (4198222) | 4198222..4198427 | + | 206 | Protein_4030 | HNH endonuclease | - |
| N2O69_RS20590 (4198695) | 4198695..4199935 | - | 1241 | Protein_4031 | helicase YjhR | - |
| N2O69_RS20595 (4200051) | 4200051..4200182 | + | 132 | WP_001309182.1 | hypothetical protein | - |
| N2O69_RS20600 (4200673) | 4200673..4200930 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| N2O69_RS20605 (4200942) | 4200942..4201487 | + | 546 | WP_001540600.1 | N-acetyltransferase | Antitoxin |
| N2O69_RS20610 (4201543) | 4201543..4202289 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| N2O69_RS20615 (4202458) | 4202458..4202676 | + | 219 | Protein_4036 | hypothetical protein | - |
| N2O69_RS20620 (4202714) | 4202714..4202830 | + | 117 | Protein_4037 | VOC family protein | - |
| N2O69_RS20625 (4203075) | 4203075..4204196 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| N2O69_RS20630 (4204193) | 4204193..4204471 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| N2O69_RS20635 (4204483) | 4204483..4205796 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimI / fimA / fimE / fimB | 4190459..4209711 | 19252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T257453 WP_001054376.1 NZ_CP104274:4200673-4200930 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19926.87 Da Isoelectric Point: 6.3277
>AT257453 WP_001540600.1 NZ_CP104274:4200942-4201487 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|