Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4046965..4047515 Replicon chromosome
Accession NZ_CP104274
Organism Escherichia coli strain Ec15103

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag N2O69_RS19855 Protein ID WP_001160966.1
Coordinates 4046965..4047279 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag N2O69_RS19860 Protein ID WP_000125568.1
Coordinates 4047282..4047515 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2O69_RS19830 (4042640) 4042640..4043926 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
N2O69_RS19835 (4043926) 4043926..4044915 + 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
N2O69_RS19840 (4044912) 4044912..4045733 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
N2O69_RS19845 (4045736) 4045736..4046113 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
N2O69_RS19850 (4046120) 4046120..4046968 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
N2O69_RS19855 (4046965) 4046965..4047279 - 315 WP_001160966.1 CcdB family protein Toxin
N2O69_RS19860 (4047282) 4047282..4047515 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
N2O69_RS19865 (4047601) 4047601..4048080 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
N2O69_RS19870 (4048272) 4048272..4050134 - 1863 WP_000377109.1 glutathione-regulated potassium-efflux system protein KefC -
N2O69_RS19875 (4050127) 4050127..4050657 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
N2O69_RS19880 (4050765) 4050765..4052096 - 1332 WP_001183207.1 MFS transporter -
N2O69_RS19885 (4052155) 4052155..4052442 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T257447 WP_001160966.1 NZ_CP104274:c4047279-4046965 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT257447 WP_000125568.1 NZ_CP104274:c4047515-4047282 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References