Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
| Location | 5086463..5087071 | Replicon | chromosome |
| Accession | NZ_CP104254 | ||
| Organism | Pseudomonas aeruginosa strain PALA1 | ||
Toxin (Protein)
| Gene name | PfiT | Uniprot ID | Q9I5J9 |
| Locus tag | PALA1_RS24225 | Protein ID | WP_003114156.1 |
| Coordinates | 5086463..5086810 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | PfiA | Uniprot ID | A0A0B0C355 |
| Locus tag | PALA1_RS24230 | Protein ID | WP_003114155.1 |
| Coordinates | 5086820..5087071 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA1_RS24195 (PALA1_04774) | 5081822..5082094 | + | 273 | WP_021264275.1 | cysteine-rich CWC family protein | - |
| PALA1_RS24200 (PALA1_04775) | 5082094..5082786 | + | 693 | WP_015503463.1 | 16S rRNA pseudouridine(516) synthase | - |
| PALA1_RS24205 (PALA1_04776) | 5082922..5083965 | + | 1044 | WP_021264274.1 | L,D-transpeptidase | - |
| PALA1_RS24210 (PALA1_04777) | 5084045..5084782 | + | 738 | WP_021264273.1 | murein L,D-transpeptidase catalytic domain family protein | - |
| PALA1_RS24215 (PALA1_04778) | 5085234..5086136 | + | 903 | WP_003085447.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
| PALA1_RS24225 (PALA1_04780) | 5086463..5086810 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA1_RS24230 | 5086820..5087071 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PALA1_RS24235 (PALA1_04781) | 5087285..5088268 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
| PALA1_RS24240 (PALA1_04782) | 5088268..5089560 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
| PALA1_RS24245 (PALA1_04784) | 5089819..5091081 | - | 1263 | WP_021264270.1 | zonular occludens toxin domain-containing protein | - |
| PALA1_RS24250 (PALA1_04785) | 5091083..5091433 | - | 351 | WP_003159569.1 | DUF2523 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | catB7 | - | 5086463..5107660 | 21197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T257431 WP_003114156.1 NZ_CP104254:c5086810-5086463 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9I5J9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B0C355 |