Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4457965..4458658 | Replicon | chromosome |
Accession | NZ_CP104254 | ||
Organism | Pseudomonas aeruginosa strain PALA1 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | PALA1_RS21120 | Protein ID | WP_003151133.1 |
Coordinates | 4457965..4458342 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | PALA1_RS21125 | Protein ID | WP_001172026.1 |
Coordinates | 4458323..4458658 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA1_RS21105 (PALA1_04174) | 4453076..4453921 | - | 846 | WP_003464995.1 | AraC family transcriptional regulator | - |
PALA1_RS21110 (PALA1_04175) | 4454158..4457187 | - | 3030 | WP_024015041.1 | Tn3 family transposase | - |
PALA1_RS21115 (PALA1_04176) | 4457171..4457773 | - | 603 | WP_010465829.1 | recombinase family protein | - |
PALA1_RS21120 (PALA1_04177) | 4457965..4458342 | + | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA1_RS21125 (PALA1_04178) | 4458323..4458658 | + | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PALA1_RS21130 (PALA1_04179) | 4458673..4458978 | + | 306 | WP_223198361.1 | transposase | - |
PALA1_RS21135 (PALA1_04180) | 4459031..4459357 | + | 327 | WP_000091614.1 | hypothetical protein | - |
PALA1_RS21140 (PALA1_04181) | 4459354..4459734 | + | 381 | WP_001054412.1 | hypothetical protein | - |
PALA1_RS21145 | 4459891..4460223 | + | 333 | WP_238176880.1 | DUF3391 domain-containing protein | - |
PALA1_RS21150 (PALA1_04182) | 4460307..4461176 | + | 870 | WP_223198360.1 | HD-GYP domain-containing protein | - |
PALA1_RS21155 (PALA1_04183) | 4461586..4461825 | + | 240 | WP_034011918.1 | ribbon-helix-helix domain-containing protein | - |
PALA1_RS21160 (PALA1_04184) | 4461825..4462235 | + | 411 | WP_034011919.1 | putative toxin-antitoxin system toxin component, PIN family | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4436153..4467767 | 31614 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T257429 WP_003151133.1 NZ_CP104254:4457965-4458342 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |