Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 615817..616431 | Replicon | chromosome |
| Accession | NZ_CP104254 | ||
| Organism | Pseudomonas aeruginosa strain PALA1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A6VBH9 |
| Locus tag | PALA1_RS02885 | Protein ID | WP_071534354.1 |
| Coordinates | 615817..615999 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A140SDX7 |
| Locus tag | PALA1_RS02890 | Protein ID | WP_012077229.1 |
| Coordinates | 616027..616431 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA1_RS02870 (PALA1_00572) | 611505..614276 | - | 2772 | WP_021263067.1 | ImpA family metalloprotease | - |
| PALA1_RS02875 | 614376..614519 | + | 144 | WP_003085001.1 | hypothetical protein | - |
| PALA1_RS02880 (PALA1_00573) | 614947..615225 | + | 279 | Protein_574 | type II toxin-antitoxin system HipA family toxin | - |
| PALA1_RS02885 (PALA1_00574) | 615817..615999 | + | 183 | WP_071534354.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PALA1_RS02890 (PALA1_00575) | 616027..616431 | + | 405 | WP_012077229.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PALA1_RS02895 (PALA1_00576) | 616474..617445 | - | 972 | WP_012077228.1 | hypothetical protein | - |
| PALA1_RS02900 (PALA1_00577) | 617430..618128 | - | 699 | WP_033896049.1 | hypothetical protein | - |
| PALA1_RS02905 (PALA1_00578) | 618128..618667 | - | 540 | WP_012074127.1 | hypothetical protein | - |
| PALA1_RS02910 (PALA1_00579) | 618664..619584 | - | 921 | WP_269972734.1 | hypothetical protein | - |
| PALA1_RS02915 (PALA1_00580) | 619581..620291 | - | 711 | WP_012074129.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 615817..666488 | 50671 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6702.74 Da Isoelectric Point: 10.4826
>T257426 WP_071534354.1 NZ_CP104254:615817-615999 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14670.54 Da Isoelectric Point: 4.4315
>AT257426 WP_012077229.1 NZ_CP104254:616027-616431 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6VBH9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140SDX7 |