Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
Location | 4096283..4096990 | Replicon | chromosome |
Accession | NZ_CP104206 | ||
Organism | Escherichia coli strain hubt-sl |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | E0J2C8 |
Locus tag | N1H45_RS20000 | Protein ID | WP_000691790.1 |
Coordinates | 4096283..4096624 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | N1H45_RS20005 | Protein ID | WP_000939438.1 |
Coordinates | 4096655..4096990 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H45_RS19980 (4092272) | 4092272..4093537 | - | 1266 | WP_001218329.1 | integrase arm-type DNA-binding domain-containing protein | - |
N1H45_RS19985 (4093930) | 4093930..4094877 | - | 948 | WP_000342500.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
N1H45_RS19990 (4094870) | 4094870..4095265 | - | 396 | WP_000152741.1 | DUF6088 family protein | - |
N1H45_RS19995 (4095335) | 4095335..4096168 | - | 834 | WP_001192746.1 | DUF4942 domain-containing protein | - |
N1H45_RS20000 (4096283) | 4096283..4096624 | - | 342 | WP_000691790.1 | TA system toxin CbtA family protein | Toxin |
N1H45_RS20005 (4096655) | 4096655..4096990 | - | 336 | WP_000939438.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N1H45_RS20010 (4096990) | 4096990..4097463 | - | 474 | WP_001292742.1 | DNA repair protein RadC | - |
N1H45_RS20015 (4097493) | 4097493..4098311 | - | 819 | WP_000761991.1 | DUF932 domain-containing protein | - |
N1H45_RS20020 (4098547) | 4098547..4099500 | - | 954 | WP_000290405.1 | hypothetical protein | - |
N1H45_RS20025 (4100093) | 4100093..4100707 | + | 615 | WP_000772909.1 | inovirus Gp2 family protein | - |
N1H45_RS20030 (4100825) | 4100825..4101043 | + | 219 | WP_001064742.1 | AlpA family phage regulatory protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimC / fimI / fimA / fimE / fimB | 4063589..4112841 | 49252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13060.08 Da Isoelectric Point: 9.4583
>T257413 WP_000691790.1 NZ_CP104206:c4096624-4096283 [Escherichia coli]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCYNTTAR
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCYNTTAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|