Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3341541..3342166 | Replicon | chromosome |
Accession | NZ_CP104206 | ||
Organism | Escherichia coli strain hubt-sl |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | N1H45_RS16350 | Protein ID | WP_000911329.1 |
Coordinates | 3341541..3341939 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | N1H45_RS16355 | Protein ID | WP_000450524.1 |
Coordinates | 3341939..3342166 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H45_RS16330 (3337448) | 3337448..3337648 | + | 201 | WP_000383836.1 | YpfN family protein | - |
N1H45_RS16335 (3337729) | 3337729..3338427 | - | 699 | WP_000679823.1 | esterase | - |
N1H45_RS16340 (3338501) | 3338501..3340516 | - | 2016 | WP_000829294.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
N1H45_RS16345 (3340531) | 3340531..3341394 | - | 864 | WP_001267505.1 | neutral zinc metallopeptidase | - |
N1H45_RS16350 (3341541) | 3341541..3341939 | - | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N1H45_RS16355 (3341939) | 3341939..3342166 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N1H45_RS16360 (3342321) | 3342321..3343034 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
N1H45_RS16365 (3343247) | 3343247..3344281 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
N1H45_RS16370 (3344298) | 3344298..3345176 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
N1H45_RS16375 (3345322) | 3345322..3345894 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
N1H45_RS16380 (3345894) | 3345894..3346364 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T257409 WP_000911329.1 NZ_CP104206:c3341939-3341541 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |