Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2362285..2362811 | Replicon | chromosome |
Accession | NZ_CP104206 | ||
Organism | Escherichia coli strain hubt-sl |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | N1H45_RS11545 | Protein ID | WP_000323025.1 |
Coordinates | 2362285..2362572 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | N1H45_RS11550 | Protein ID | WP_000534858.1 |
Coordinates | 2362572..2362811 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H45_RS11495 (2357309) | 2357309..2357524 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
N1H45_RS11500 (2357744) | 2357744..2357914 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
N1H45_RS11505 (2358278) | 2358278..2358493 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
N1H45_RS11510 (2358794) | 2358794..2359006 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
N1H45_RS11515 (2359061) | 2359061..2359150 | + | 90 | WP_120795389.1 | hypothetical protein | - |
N1H45_RS11520 (2359428) | 2359428..2360180 | - | 753 | WP_001047135.1 | antitermination protein | - |
N1H45_RS11525 (2360194) | 2360194..2361243 | - | 1050 | WP_001265199.1 | DUF968 domain-containing protein | - |
N1H45_RS11530 (2361245) | 2361245..2361523 | - | 279 | WP_012304870.1 | hypothetical protein | - |
N1H45_RS11535 (2361590) | 2361590..2361841 | - | 252 | WP_000980994.1 | protein Rem | - |
N1H45_RS11540 (2362058) | 2362058..2362213 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
N1H45_RS11545 (2362285) | 2362285..2362572 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
N1H45_RS11550 (2362572) | 2362572..2362811 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
N1H45_RS11555 (2362836) | 2362836..2363141 | + | 306 | WP_001326990.1 | protein YdfV | - |
N1H45_RS11560 (2363344) | 2363344..2363676 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
N1H45_RS11565 (2364113) | 2364113..2364262 | - | 150 | WP_011443592.1 | protein YdfW | - |
N1H45_RS11570 (2364383) | 2364383..2365405 | - | 1023 | Protein_2264 | ISNCY family transposase | - |
N1H45_RS11575 (2366195) | 2366195..2366482 | - | 288 | Protein_2265 | hypothetical protein | - |
N1H45_RS11580 (2366960) | 2366960..2367449 | - | 490 | Protein_2266 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2328315..2377312 | 48997 | |
- | inside | Prophage | - | - | 2329757..2394156 | 64399 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T257403 WP_000323025.1 NZ_CP104206:c2362572-2362285 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|