Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2271085..2271723 | Replicon | chromosome |
| Accession | NZ_CP104206 | ||
| Organism | Escherichia coli strain hubt-sl | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | N1H45_RS11075 | Protein ID | WP_000813794.1 |
| Coordinates | 2271085..2271261 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N1H45_RS11080 | Protein ID | WP_001270285.1 |
| Coordinates | 2271307..2271723 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1H45_RS11055 (2266704) | 2266704..2267879 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
| N1H45_RS11060 (2267971) | 2267971..2268507 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| N1H45_RS11065 (2268580) | 2268580..2270541 | + | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| N1H45_RS11070 (2270633) | 2270633..2270863 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| N1H45_RS11075 (2271085) | 2271085..2271261 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| N1H45_RS11080 (2271307) | 2271307..2271723 | + | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| N1H45_RS11085 (2271802) | 2271802..2273208 | + | 1407 | WP_000760593.1 | PLP-dependent aminotransferase family protein | - |
| N1H45_RS11090 (2273453) | 2273453..2274598 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| N1H45_RS11095 (2274616) | 2274616..2275629 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| N1H45_RS11100 (2275630) | 2275630..2276571 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2265516..2266664 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257401 WP_000813794.1 NZ_CP104206:2271085-2271261 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT257401 WP_001270285.1 NZ_CP104206:2271307-2271723 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|