Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1218157..1218775 | Replicon | chromosome |
Accession | NZ_CP104206 | ||
Organism | Escherichia coli strain hubt-sl |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N1H45_RS05895 | Protein ID | WP_001291435.1 |
Coordinates | 1218157..1218375 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N1H45_RS05900 | Protein ID | WP_000344800.1 |
Coordinates | 1218401..1218775 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H45_RS05860 (1213446) | 1213446..1214018 | + | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
N1H45_RS05865 (1214049) | 1214049..1214360 | - | 312 | WP_000409911.1 | MGMT family protein | - |
N1H45_RS05875 (1214739) | 1214739..1215092 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N1H45_RS05880 (1215134) | 1215134..1216684 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N1H45_RS05885 (1216848) | 1216848..1217318 | - | 471 | WP_000136192.1 | YlaC family protein | - |
N1H45_RS05890 (1217434) | 1217434..1217985 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
N1H45_RS05895 (1218157) | 1218157..1218375 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N1H45_RS05900 (1218401) | 1218401..1218775 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N1H45_RS05905 (1219321) | 1219321..1222470 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N1H45_RS05910 (1222493) | 1222493..1223686 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T257397 WP_001291435.1 NZ_CP104206:c1218375-1218157 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT257397 WP_000344800.1 NZ_CP104206:c1218775-1218401 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |