Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1183861..1184698 | Replicon | chromosome |
Accession | NZ_CP104206 | ||
Organism | Escherichia coli strain hubt-sl |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | N1H45_RS05725 | Protein ID | WP_000227784.1 |
Coordinates | 1183861..1184403 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | N1H45_RS05730 | Protein ID | WP_001297137.1 |
Coordinates | 1184387..1184698 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H45_RS05705 (1179411) | 1179411..1180322 | - | 912 | WP_000705849.1 | 2-dehydropantoate 2-reductase | - |
N1H45_RS05710 (1180490) | 1180490..1180981 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
N1H45_RS05715 (1181109) | 1181109..1182473 | - | 1365 | WP_001000978.1 | MFS transporter | - |
N1H45_RS05720 (1182881) | 1182881..1183805 | + | 925 | Protein_1123 | sel1 repeat family protein | - |
N1H45_RS05725 (1183861) | 1183861..1184403 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
N1H45_RS05730 (1184387) | 1184387..1184698 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
N1H45_RS05735 (1184883) | 1184883..1185773 | - | 891 | WP_000971336.1 | heme o synthase | - |
N1H45_RS05740 (1185785) | 1185785..1186114 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
N1H45_RS05745 (1186114) | 1186114..1186728 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
N1H45_RS05750 (1186718) | 1186718..1188709 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
N1H45_RS05755 (1188731) | 1188731..1189678 | - | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T257396 WP_000227784.1 NZ_CP104206:c1184403-1183861 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|