Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1058469..1059052 | Replicon | chromosome |
Accession | NZ_CP104206 | ||
Organism | Escherichia coli strain hubt-sl |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | N1H45_RS05105 | Protein ID | WP_000254738.1 |
Coordinates | 1058717..1059052 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | N1H45_RS05100 | Protein ID | WP_000581937.1 |
Coordinates | 1058469..1058717 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H45_RS05090 (1054808) | 1054808..1056109 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
N1H45_RS05095 (1056157) | 1056157..1058391 | + | 2235 | WP_000226812.1 | GTP diphosphokinase | - |
N1H45_RS05100 (1058469) | 1058469..1058717 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N1H45_RS05105 (1058717) | 1058717..1059052 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
N1H45_RS05110 (1059123) | 1059123..1059914 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N1H45_RS05115 (1060142) | 1060142..1061779 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N1H45_RS05120 (1061867) | 1061867..1063165 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T257395 WP_000254738.1 NZ_CP104206:1058717-1059052 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|