Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 885106..885760 | Replicon | chromosome |
Accession | NZ_CP104206 | ||
Organism | Escherichia coli strain hubt-sl |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | N1H45_RS04345 | Protein ID | WP_000244772.1 |
Coordinates | 885353..885760 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N1H45_RS04340 | Protein ID | WP_000354046.1 |
Coordinates | 885106..885372 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H45_RS04315 (880394) | 880394..881137 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
N1H45_RS04320 (881194) | 881194..882627 | - | 1434 | WP_001307385.1 | 6-phospho-beta-glucosidase BglA | - |
N1H45_RS04325 (882672) | 882672..882983 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
N1H45_RS04330 (883147) | 883147..883806 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
N1H45_RS04335 (883883) | 883883..884863 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
N1H45_RS04340 (885106) | 885106..885372 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N1H45_RS04345 (885353) | 885353..885760 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
N1H45_RS04350 (885800) | 885800..886321 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
N1H45_RS04355 (886433) | 886433..887329 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
N1H45_RS04360 (887354) | 887354..888064 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N1H45_RS04365 (888070) | 888070..889803 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T257394 WP_000244772.1 NZ_CP104206:885353-885760 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |