Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 47684..48403 | Replicon | chromosome |
| Accession | NZ_CP104206 | ||
| Organism | Escherichia coli strain hubt-sl | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | E0J373 |
| Locus tag | N1H45_RS00240 | Protein ID | WP_001095907.1 |
| Coordinates | 47684..48004 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E0J374 |
| Locus tag | N1H45_RS00245 | Protein ID | WP_001192122.1 |
| Coordinates | 48038..48403 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1H45_RS00215 (43362) | 43362..43655 | - | 294 | WP_000805509.1 | protein YicS | - |
| N1H45_RS00220 (43877) | 43877..44695 | + | 819 | WP_000779426.1 | lipoprotein NlpA | - |
| N1H45_RS00225 (44699) | 44699..45622 | - | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
| N1H45_RS00230 (45733) | 45733..46917 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| N1H45_RS00235 (47314) | 47314..47475 | - | 162 | Protein_46 | virulence RhuM family protein | - |
| N1H45_RS00240 (47684) | 47684..48004 | - | 321 | WP_001095907.1 | TA system toxin CbtA family protein | Toxin |
| N1H45_RS00245 (48038) | 48038..48403 | - | 366 | WP_001192122.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N1H45_RS00250 (48435) | 48435..48656 | - | 222 | WP_000691985.1 | DUF987 family protein | - |
| N1H45_RS00255 (48665) | 48665..49135 | - | 471 | WP_000104319.1 | DNA repair protein RadC | - |
| N1H45_RS00260 (49205) | 49205..50026 | - | 822 | WP_000197395.1 | DUF932 domain-containing protein | - |
| N1H45_RS00265 (50098) | 50098..50589 | - | 492 | WP_244401893.1 | hypothetical protein | - |
| N1H45_RS00270 (50791) | 50791..51039 | - | 249 | WP_260579116.1 | hypothetical protein | - |
| N1H45_RS00275 (51112) | 51112..52320 | + | 1209 | WP_001339197.1 | IS4-like element ISVsa5 family transposase | - |
| N1H45_RS00280 (52330) | 52330..52932 | - | 603 | WP_260579117.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12184.76 Da Isoelectric Point: 5.5740
>T257390 WP_001095907.1 NZ_CP104206:c48004-47684 [Escherichia coli]
MNTPTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVRRAQFNLGLKRS
MNTPTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVRRAQFNLGLKRS
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|