Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ParE-CopA/RHH(antitoxin) |
Location | 1227948..1228498 | Replicon | chromosome |
Accession | NZ_CP104202 | ||
Organism | Chlorobaculum sp. MV4-Y |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | NY406_RS05935 | Protein ID | WP_260533211.1 |
Coordinates | 1227948..1228235 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | copA | Uniprot ID | - |
Locus tag | NY406_RS05940 | Protein ID | WP_260533212.1 |
Coordinates | 1228223..1228498 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY406_RS05915 (NY406_05915) | 1223063..1223629 | + | 567 | WP_260533208.1 | nitroreductase family protein | - |
NY406_RS05920 (NY406_05920) | 1223805..1224740 | + | 936 | WP_260533209.1 | hypothetical protein | - |
NY406_RS05925 (NY406_05925) | 1224844..1226820 | + | 1977 | WP_260533210.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
NY406_RS05930 (NY406_05930) | 1226888..1227043 | + | 156 | WP_260633755.1 | hypothetical protein | - |
NY406_RS05935 (NY406_05935) | 1227948..1228235 | - | 288 | WP_260533211.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NY406_RS05940 (NY406_05940) | 1228223..1228498 | - | 276 | WP_260533212.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
NY406_RS05945 (NY406_05945) | 1228558..1228914 | - | 357 | WP_260633756.1 | HAD family acid phosphatase | - |
NY406_RS05950 (NY406_05950) | 1228930..1229205 | - | 276 | WP_260533213.1 | hypothetical protein | - |
NY406_RS05955 (NY406_05955) | 1229517..1229936 | - | 420 | WP_260533214.1 | OsmC family protein | - |
NY406_RS05960 (NY406_05960) | 1230288..1231343 | + | 1056 | WP_260533215.1 | rod shape-determining protein | - |
NY406_RS05965 (NY406_05965) | 1231446..1233179 | - | 1734 | WP_260533216.1 | caspase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10785.38 Da Isoelectric Point: 6.7271
>T257389 WP_260533211.1 NZ_CP104202:c1228235-1227948 [Chlorobaculum sp. MV4-Y]
VPEIKWLPEALVDVERLHAFLHEKSPDAASRAARVILDGAGLLQSIPEIGRPMNDETGRRELVISFGAGAFVLRYIWDKN
DTVVIIRVWHSRENR
VPEIKWLPEALVDVERLHAFLHEKSPDAASRAARVILDGAGLLQSIPEIGRPMNDETGRRELVISFGAGAFVLRYIWDKN
DTVVIIRVWHSRENR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|