Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 26482..27007 Replicon plasmid pCHN23026_1
Accession NZ_CP104197
Organism Klebsiella pneumoniae strain CHN23026

Toxin (Protein)


Gene name ccdB Uniprot ID J5VBT8
Locus tag N3931_RS26495 Protein ID WP_004197633.1
Coordinates 26702..27007 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A9E1GDP8
Locus tag N3931_RS26490 Protein ID WP_004197642.1
Coordinates 26482..26700 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N3931_RS26465 (N3931_26465) 21729..22697 + 969 WP_075211999.1 IS5 family transposase -
N3931_RS26470 (N3931_26470) 23169..23960 - 792 WP_221928726.1 ribbon-helix-helix domain-containing protein -
N3931_RS26475 (N3931_26475) 24143..25171 - 1029 WP_032445668.1 Abi family protein -
N3931_RS26480 (N3931_26480) 25332..25913 - 582 WP_072310991.1 hypothetical protein -
N3931_RS26485 (N3931_26485) 26064..26312 + 249 Protein_27 hypothetical protein -
N3931_RS26490 (N3931_26490) 26482..26700 + 219 WP_004197642.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
N3931_RS26495 (N3931_26495) 26702..27007 + 306 WP_004197633.1 type II toxin-antitoxin system toxin CcdB Toxin
N3931_RS26500 (N3931_26500) 27176..27571 + 396 WP_017899885.1 hypothetical protein -
N3931_RS26505 (N3931_26505) 27598..27921 + 324 WP_004197641.1 hypothetical protein -
N3931_RS26510 (N3931_26510) 27918..28934 + 1017 WP_164530167.1 hypothetical protein -
N3931_RS26515 (N3931_26515) 29132..29917 + 786 WP_046664219.1 site-specific integrase -
N3931_RS26520 (N3931_26520) 30366..31121 + 756 WP_001568031.1 replication initiation protein RepE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mcr-8 - 1..101251 101251
- flank IS/Tn mcr-8 - 15672..22697 7025


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11585.27 Da        Isoelectric Point: 6.4661

>T257386 WP_004197633.1 NZ_CP104197:26702-27007 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8376.34 Da        Isoelectric Point: 4.7405

>AT257386 WP_004197642.1 NZ_CP104197:26482-26700 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A5MCG5

Antitoxin

Source ID Structure

References