Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5260581..5261206 | Replicon | chromosome |
Accession | NZ_CP104196 | ||
Organism | Klebsiella pneumoniae strain CHN23026 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | N3931_RS25985 | Protein ID | WP_002882817.1 |
Coordinates | 5260581..5260964 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | N3931_RS25990 | Protein ID | WP_004150355.1 |
Coordinates | 5260964..5261206 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N3931_RS25970 (N3931_25970) | 5257947..5258849 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
N3931_RS25975 (N3931_25975) | 5258846..5259481 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
N3931_RS25980 (N3931_25980) | 5259478..5260407 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
N3931_RS25985 (N3931_25985) | 5260581..5260964 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N3931_RS25990 (N3931_25990) | 5260964..5261206 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
N3931_RS25995 (N3931_25995) | 5261411..5262328 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
N3931_RS26000 (N3931_26000) | 5262342..5263283 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
N3931_RS26005 (N3931_26005) | 5263328..5263765 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
N3931_RS26010 (N3931_26010) | 5263762..5264622 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
N3931_RS26015 (N3931_26015) | 5264616..5265215 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T257385 WP_002882817.1 NZ_CP104196:c5260964-5260581 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |