Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4780347..4780863 | Replicon | chromosome |
| Accession | NZ_CP104196 | ||
| Organism | Klebsiella pneumoniae strain CHN23026 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | N3931_RS23680 | Protein ID | WP_002886902.1 |
| Coordinates | 4780347..4780631 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | N3931_RS23685 | Protein ID | WP_002886901.1 |
| Coordinates | 4780621..4780863 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N3931_RS23655 (N3931_23655) | 4775831..4776094 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| N3931_RS23660 (N3931_23660) | 4776224..4776397 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| N3931_RS23665 (N3931_23665) | 4776400..4777143 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| N3931_RS23670 (N3931_23670) | 4777500..4779638 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| N3931_RS23675 (N3931_23675) | 4779879..4780343 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| N3931_RS23680 (N3931_23680) | 4780347..4780631 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N3931_RS23685 (N3931_23685) | 4780621..4780863 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N3931_RS23690 (N3931_23690) | 4780941..4782851 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| N3931_RS23695 (N3931_23695) | 4782874..4784028 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| N3931_RS23700 (N3931_23700) | 4784094..4784834 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T257383 WP_002886902.1 NZ_CP104196:c4780631-4780347 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |