Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4064750..4065369 Replicon chromosome
Accession NZ_CP104196
Organism Klebsiella pneumoniae strain CHN23026

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N3931_RS20250 Protein ID WP_002892050.1
Coordinates 4065151..4065369 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N3931_RS20245 Protein ID WP_002892066.1
Coordinates 4064750..4065124 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N3931_RS20235 (N3931_20235) 4059902..4061095 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N3931_RS20240 (N3931_20240) 4061118..4064264 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
N3931_RS20245 (N3931_20245) 4064750..4065124 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N3931_RS20250 (N3931_20250) 4065151..4065369 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N3931_RS20255 (N3931_20255) 4065528..4066094 + 567 WP_002892030.1 maltose O-acetyltransferase -
N3931_RS20260 (N3931_20260) 4066066..4066206 - 141 WP_004147370.1 hypothetical protein -
N3931_RS20265 (N3931_20265) 4066227..4066697 + 471 WP_002892026.1 YlaC family protein -
N3931_RS20270 (N3931_20270) 4066672..4068123 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
N3931_RS20275 (N3931_20275) 4068224..4068922 + 699 WP_002892021.1 GNAT family protein -
N3931_RS20280 (N3931_20280) 4068919..4069059 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N3931_RS20285 (N3931_20285) 4069059..4069322 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T257381 WP_002892050.1 NZ_CP104196:4065151-4065369 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT257381 WP_002892066.1 NZ_CP104196:4064750-4065124 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References