Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 325773..326359 Replicon chromosome
Accession NZ_CP104196
Organism Klebsiella pneumoniae strain CHN23026

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag N3931_RS01515 Protein ID WP_002920800.1
Coordinates 325991..326359 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag N3931_RS01510 Protein ID WP_002920802.1
Coordinates 325773..325994 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N3931_RS01490 (N3931_01490) 321930..322856 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N3931_RS01495 (N3931_01495) 322853..324130 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
N3931_RS01500 (N3931_01500) 324127..324894 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N3931_RS01505 (N3931_01505) 324896..325609 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N3931_RS01510 (N3931_01510) 325773..325994 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N3931_RS01515 (N3931_01515) 325991..326359 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N3931_RS01520 (N3931_01520) 326632..327948 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N3931_RS01525 (N3931_01525) 328055..328942 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N3931_RS01530 (N3931_01530) 328939..329784 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N3931_RS01535 (N3931_01535) 329786..330040 + 255 Protein_303 ATP-binding cassette domain-containing protein -
N3931_RS01540 (N3931_01540) 330153..330341 + 189 WP_000957857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 330351..331550 1199


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T257372 WP_002920800.1 NZ_CP104196:325991-326359 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT257372 WP_002920802.1 NZ_CP104196:325773-325994 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References