Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3411643..3412307 | Replicon | chromosome |
Accession | NZ_CP104174 | ||
Organism | Bradyrhizobium sp. CB1015 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N2604_RS15595 | Protein ID | WP_260375509.1 |
Coordinates | 3411643..3412050 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N2604_RS15600 | Protein ID | WP_260375510.1 |
Coordinates | 3412047..3412307 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2604_RS15570 (N2604_15570) | 3406684..3407940 | + | 1257 | WP_260375504.1 | hydroxysqualene dehydroxylase HpnE | - |
N2604_RS15575 (N2604_15575) | 3408005..3409957 | + | 1953 | WP_260375505.1 | squalene--hopene cyclase | - |
N2604_RS15580 (N2604_15580) | 3409954..3410703 | + | 750 | WP_260375506.1 | phosphorylase | - |
N2604_RS15585 (N2604_15585) | 3410868..3411143 | + | 276 | WP_260375507.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
N2604_RS15590 (N2604_15590) | 3411130..3411522 | + | 393 | WP_260375508.1 | type II toxin-antitoxin system VapC family toxin | - |
N2604_RS15595 (N2604_15595) | 3411643..3412050 | - | 408 | WP_260375509.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N2604_RS15600 (N2604_15600) | 3412047..3412307 | - | 261 | WP_260375510.1 | antitoxin | Antitoxin |
N2604_RS15605 (N2604_15605) | 3413267..3414172 | + | 906 | WP_260375511.1 | integrase core domain-containing protein | - |
N2604_RS15610 (N2604_15610) | 3414366..3415526 | - | 1161 | WP_197946317.1 | adenosyl-hopene transferase HpnH | - |
N2604_RS15615 (N2604_15615) | 3415563..3416489 | - | 927 | WP_260375512.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15122.24 Da Isoelectric Point: 4.7783
>T257370 WP_260375509.1 NZ_CP104174:c3412050-3411643 [Bradyrhizobium sp. CB1015]
MTKWLLDTNAVIALVTRRSEPLLRRVESTEPGALAISSIVAHELYFGAYRSQKIEFNLETLRLVFTDLDIVDLDQEDARA
AGEIRAELARRSTPIGPYDLLIAGQAIARGLPLVSNNTAEFQRIAGLRLEDWTRD
MTKWLLDTNAVIALVTRRSEPLLRRVESTEPGALAISSIVAHELYFGAYRSQKIEFNLETLRLVFTDLDIVDLDQEDARA
AGEIRAELARRSTPIGPYDLLIAGQAIARGLPLVSNNTAEFQRIAGLRLEDWTRD
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|