Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 556135..556766 | Replicon | chromosome |
Accession | NZ_CP104174 | ||
Organism | Bradyrhizobium sp. CB1015 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N2604_RS02590 | Protein ID | WP_260373646.1 |
Coordinates | 556362..556766 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N2604_RS02585 | Protein ID | WP_260376415.1 |
Coordinates | 556135..556365 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2604_RS02570 (N2604_02570) | 552654..553352 | - | 699 | WP_260373643.1 | hypothetical protein | - |
N2604_RS02575 (N2604_02575) | 553533..554597 | + | 1065 | WP_260373644.1 | LysM peptidoglycan-binding domain-containing protein | - |
N2604_RS02580 (N2604_02580) | 554768..556057 | + | 1290 | WP_260373645.1 | Spy/CpxP family protein refolding chaperone | - |
N2604_RS02585 (N2604_02585) | 556135..556365 | + | 231 | WP_260376415.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N2604_RS02590 (N2604_02590) | 556362..556766 | + | 405 | WP_260373646.1 | PIN domain-containing protein | Toxin |
N2604_RS02595 (N2604_02595) | 556815..557681 | - | 867 | WP_260373647.1 | hypothetical protein | - |
N2604_RS02600 (N2604_02600) | 557900..560347 | - | 2448 | WP_260373648.1 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14548.56 Da Isoelectric Point: 5.5712
>T257369 WP_260373646.1 NZ_CP104174:556362-556766 [Bradyrhizobium sp. CB1015]
VSAFFDSNILIYAYSTDARRGPALNALAGGGVISAQVLNEFTNVLRKKQQQDWPVIEAAVQTIRFRFPDIVPLTADTHAA
AIALARDHSVAFYDALIIASAIETGCDTLYSEDLQHRRSIGGLTILNPFLGMTP
VSAFFDSNILIYAYSTDARRGPALNALAGGGVISAQVLNEFTNVLRKKQQQDWPVIEAAVQTIRFRFPDIVPLTADTHAA
AIALARDHSVAFYDALIIASAIETGCDTLYSEDLQHRRSIGGLTILNPFLGMTP
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|