Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 6506968..6507608 | Replicon | chromosome |
| Accession | NZ_CP104172 | ||
| Organism | Bradyrhizobium sp. CB3035 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | N2603_RS30815 | Protein ID | WP_018647982.1 |
| Coordinates | 6506968..6507258 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A562S0U1 |
| Locus tag | N2603_RS30820 | Protein ID | WP_018647983.1 |
| Coordinates | 6507258..6507608 (+) | Length | 117 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2603_RS30790 (N2603_30790) | 6502176..6502814 | - | 639 | WP_018647977.1 | DUF1109 domain-containing protein | - |
| N2603_RS30795 (N2603_30795) | 6502817..6503362 | - | 546 | WP_018647978.1 | sigma-70 family RNA polymerase sigma factor | - |
| N2603_RS30800 (N2603_30800) | 6503653..6504327 | + | 675 | WP_260385084.1 | hypothetical protein | - |
| N2603_RS30805 (N2603_30805) | 6504468..6505247 | + | 780 | WP_260385085.1 | enoyl-CoA hydratase | - |
| N2603_RS30810 (N2603_30810) | 6505436..6506866 | + | 1431 | WP_260385086.1 | TolC family outer membrane protein | - |
| N2603_RS30815 (N2603_30815) | 6506968..6507258 | + | 291 | WP_018647982.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N2603_RS30820 (N2603_30820) | 6507258..6507608 | + | 351 | WP_018647983.1 | putative addiction module antidote protein | Antitoxin |
| N2603_RS30825 (N2603_30825) | 6507694..6508251 | + | 558 | WP_260385087.1 | hypothetical protein | - |
| N2603_RS30830 (N2603_30830) | 6508302..6509264 | + | 963 | WP_018647985.1 | amidohydrolase family protein | - |
| N2603_RS30835 (N2603_30835) | 6509267..6512383 | - | 3117 | WP_260385088.1 | CusA/CzcA family heavy metal efflux RND transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11098.68 Da Isoelectric Point: 9.9817
>T257367 WP_018647982.1 NZ_CP104172:6506968-6507258 [Bradyrhizobium sp. CB3035]
MVEVRQTEHFSEWLSRLRDASAVARITVRIRRMEMGNPGDSKSVGRNIREMRIDYGPGYRIYYVQRGAQIVILLCGGDKR
TQRQDIELAQQLAETS
MVEVRQTEHFSEWLSRLRDASAVARITVRIRRMEMGNPGDSKSVGRNIREMRIDYGPGYRIYYVQRGAQIVILLCGGDKR
TQRQDIELAQQLAETS
Download Length: 291 bp
Antitoxin
Download Length: 117 a.a. Molecular weight: 12215.95 Da Isoelectric Point: 10.8470
>AT257367 WP_018647983.1 NZ_CP104172:6507258-6507608 [Bradyrhizobium sp. CB3035]
MPKAAKTTAKTASKTTRFDAADYLNTEERQAAYIAAALETGDADFVRDALGLVARARGMSAIAKKAGLNRESLYKALGET
GNPEFGTVMRIVGALGLTLSAQPATSGRTPKRRRAA
MPKAAKTTAKTASKTTRFDAADYLNTEERQAAYIAAALETGDADFVRDALGLVARARGMSAIAKKAGLNRESLYKALGET
GNPEFGTVMRIVGALGLTLSAQPATSGRTPKRRRAA
Download Length: 351 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|