Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 6946945..6947578 | Replicon | chromosome |
Accession | NZ_CP104171 | ||
Organism | Bradyrhizobium sp. NC92 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N2602_RS32415 | Protein ID | WP_260380647.1 |
Coordinates | 6947390..6947578 (-) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N2602_RS32410 | Protein ID | WP_260380646.1 |
Coordinates | 6946945..6947337 (-) | Length | 131 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2602_RS32380 (N2602_32380) | 6942454..6942807 | - | 354 | WP_260383760.1 | IS66 family insertion sequence element accessory protein TnpB | - |
N2602_RS32385 (N2602_32385) | 6942804..6943265 | - | 462 | WP_260380641.1 | transposase | - |
N2602_RS32390 (N2602_32390) | 6943664..6943798 | - | 135 | WP_260380642.1 | hypothetical protein | - |
N2602_RS32395 (N2602_32395) | 6944144..6944467 | - | 324 | WP_260380643.1 | hypothetical protein | - |
N2602_RS32400 (N2602_32400) | 6944619..6944825 | + | 207 | WP_260380644.1 | cold-shock protein | - |
N2602_RS32405 (N2602_32405) | 6944896..6946239 | - | 1344 | WP_260380645.1 | IS5 family transposase | - |
N2602_RS32410 (N2602_32410) | 6946945..6947337 | - | 393 | WP_260380646.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N2602_RS32415 (N2602_32415) | 6947390..6947578 | - | 189 | WP_260380647.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N2602_RS32420 (N2602_32420) | 6948014..6949258 | - | 1245 | WP_260380648.1 | hypothetical protein | - |
N2602_RS32425 (N2602_32425) | 6949255..6950490 | - | 1236 | WP_260380649.1 | ATP-grasp domain-containing protein | - |
N2602_RS32430 (N2602_32430) | 6950420..6951616 | - | 1197 | WP_260380650.1 | saccharopine dehydrogenase C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 6744268..6947578 | 203310 | |
- | flank | IS/Tn | - | - | 6944896..6946239 | 1343 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6867.12 Da Isoelectric Point: 11.2962
>T257366 WP_260380647.1 NZ_CP104171:c6947578-6947390 [Bradyrhizobium sp. NC92]
MKSTDIIAALKADGWTQVAQKGSHVQFKHPIKPGRVTVPHPKKDIPIGTVRSIEKQSVLKLR
MKSTDIIAALKADGWTQVAQKGSHVQFKHPIKPGRVTVPHPKKDIPIGTVRSIEKQSVLKLR
Download Length: 189 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 13799.56 Da Isoelectric Point: 4.3227
>AT257366 WP_260380646.1 NZ_CP104171:c6947337-6946945 [Bradyrhizobium sp. NC92]
MRYYIVLIHKDADSDYGVSFPDLPGVISAGSTLDEAREMAAEALALHLRGLAEDGEAVPEPSSLEQIMANADNKDGVAVL
IPAPAEEVKSVRVNITLPADVLSEIDRHAEQQGFTRSGFLAQAAKKALAA
MRYYIVLIHKDADSDYGVSFPDLPGVISAGSTLDEAREMAAEALALHLRGLAEDGEAVPEPSSLEQIMANADNKDGVAVL
IPAPAEEVKSVRVNITLPADVLSEIDRHAEQQGFTRSGFLAQAAKKALAA
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|