Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 6107483..6107988 | Replicon | chromosome |
Accession | NZ_CP104170 | ||
Organism | Pseudomonas aeruginosa strain HW001G |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | NDR95_RS28460 | Protein ID | WP_003121619.1 |
Coordinates | 6107483..6107764 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | NDR95_RS28465 | Protein ID | WP_003112628.1 |
Coordinates | 6107761..6107988 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDR95_RS28435 (NDR95_28435) | 6102734..6104083 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
NDR95_RS28440 (NDR95_28440) | 6104132..6104818 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
NDR95_RS28445 (NDR95_28445) | 6104919..6105653 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
NDR95_RS28450 (NDR95_28450) | 6105833..6106243 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
NDR95_RS28455 (NDR95_28455) | 6106275..6107183 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
NDR95_RS28460 (NDR95_28460) | 6107483..6107764 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
NDR95_RS28465 (NDR95_28465) | 6107761..6107988 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NDR95_RS28470 (NDR95_28470) | 6108164..6108784 | - | 621 | WP_003101226.1 | hypothetical protein | - |
NDR95_RS28475 (NDR95_28475) | 6108885..6109385 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
NDR95_RS28480 (NDR95_28480) | 6109458..6109799 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
NDR95_RS28485 (NDR95_28485) | 6109881..6111308 | - | 1428 | WP_003083784.1 | GABA permease | - |
NDR95_RS28490 (NDR95_28490) | 6111477..6112970 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T257365 WP_003121619.1 NZ_CP104170:c6107764-6107483 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I707 |