Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4640890..4641530 | Replicon | chromosome |
Accession | NZ_CP104170 | ||
Organism | Pseudomonas aeruginosa strain HW001G |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NDR95_RS21765 | Protein ID | WP_003134109.1 |
Coordinates | 4640890..4641300 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NDR95_RS21770 | Protein ID | WP_031628173.1 |
Coordinates | 4641300..4641530 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDR95_RS21735 (NDR95_21735) | 4637267..4637995 | + | 729 | WP_260352473.1 | TIGR03761 family integrating conjugative element protein | - |
NDR95_RS21740 (NDR95_21740) | 4638001..4638549 | + | 549 | WP_260352475.1 | DUF3158 family protein | - |
NDR95_RS21745 (NDR95_21745) | 4638597..4639439 | + | 843 | WP_016264250.1 | Rha family transcriptional regulator | - |
NDR95_RS21750 (NDR95_21750) | 4639469..4639957 | + | 489 | WP_003134107.1 | single-stranded DNA-binding protein | - |
NDR95_RS21755 (NDR95_21755) | 4640214..4640381 | + | 168 | WP_128729268.1 | CrpP family ICE-associated protein | - |
NDR95_RS21760 (NDR95_21760) | 4640677..4640874 | - | 198 | WP_260352484.1 | hypothetical protein | - |
NDR95_RS21765 (NDR95_21765) | 4640890..4641300 | - | 411 | WP_003134109.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NDR95_RS21770 (NDR95_21770) | 4641300..4641530 | - | 231 | WP_031628173.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NDR95_RS21775 (NDR95_21775) | 4641848..4642729 | + | 882 | Protein_4299 | DNA topoisomerase | - |
NDR95_RS21780 (NDR95_21780) | 4642845..4644344 | + | 1500 | WP_101516663.1 | IS21-like element ISPst3 family transposase | - |
NDR95_RS21785 (NDR95_21785) | 4644337..4645140 | + | 804 | WP_011911830.1 | IS21-like element ISPst3 family helper ATPase IstB | - |
NDR95_RS21790 (NDR95_21790) | 4645374..4646039 | + | 666 | WP_260352489.1 | helicase-related protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4622315..4651767 | 29452 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15452.78 Da Isoelectric Point: 7.3233
>T257363 WP_003134109.1 NZ_CP104170:c4641300-4640890 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|