257358

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 773387..774044 Replicon chromosome
Accession NZ_CP104170
Organism Pseudomonas aeruginosa strain HW001G

Toxin (Protein)


Gene name hicA Uniprot ID A0A8G3IXE4
Locus tag NDR95_RS03670 Protein ID WP_003098540.1
Coordinates 773862..774044 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NDR95_RS03665 Protein ID WP_034013789.1
Coordinates 773387..773815 (-) Length 143 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDR95_RS03620 (NDR95_03620) 769142..769846 + 705 WP_260353198.1 phage regulatory protein/antirepressor Ant -
NDR95_RS03625 (NDR95_03625) 769953..770363 + 411 WP_260353300.1 helix-turn-helix domain-containing protein -
NDR95_RS03630 (NDR95_03630) 770335..770667 + 333 WP_260353199.1 hypothetical protein -
NDR95_RS03635 (NDR95_03635) 770664..771347 + 684 WP_073654415.1 replication protein P -
NDR95_RS03640 (NDR95_03640) 771344..771550 + 207 WP_043496317.1 hypothetical protein -
NDR95_RS03645 (NDR95_03645) 771547..771918 + 372 WP_260353200.1 Ref family protein -
NDR95_RS03650 (NDR95_03650) 771915..772262 + 348 WP_031630620.1 RusA family crossover junction endodeoxyribonuclease -
NDR95_RS03655 (NDR95_03655) 772259..772558 + 300 WP_033950491.1 hypothetical protein -
NDR95_RS03660 (NDR95_03660) 772596..773270 + 675 WP_260353201.1 hypothetical protein -
NDR95_RS03665 (NDR95_03665) 773387..773815 - 429 WP_034013789.1 transcriptional regulator Antitoxin
NDR95_RS03670 (NDR95_03670) 773862..774044 - 183 WP_003098540.1 type II toxin-antitoxin system HicA family toxin Toxin
NDR95_RS03675 (NDR95_03675) 774260..774781 + 522 WP_181154805.1 GspH/FimT family pseudopilin -
NDR95_RS03680 (NDR95_03680) 774964..775296 + 333 WP_014602590.1 phage holin, lambda family -
NDR95_RS03685 (NDR95_03685) 775293..775910 + 618 WP_105248046.1 glycoside hydrolase family 19 protein -
NDR95_RS03690 (NDR95_03690) 775928..776359 + 432 WP_174220617.1 hypothetical protein -
NDR95_RS03695 (NDR95_03695) 776451..776870 + 420 WP_105248047.1 HNH endonuclease signature motif containing protein -
NDR95_RS03700 (NDR95_03700) 777001..777411 + 411 WP_020750362.1 P27 family phage terminase small subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 750197..802974 52777


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(7-78)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6746.86 Da        Isoelectric Point: 11.0775

>T257358 WP_003098540.1 NZ_CP104170:c774044-773862 [Pseudomonas aeruginosa]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 143 a.a.        Molecular weight: 15799.02 Da        Isoelectric Point: 4.6562

>AT257358 WP_034013789.1 NZ_CP104170:c773815-773387 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKAHAISEAVDAIESTLSLYVDQRREIPAASQAQPGERVIHLPAVTVA
KVALWNEMIRRDMRKADLCRLLGIAQIQGDRLVDFLHNTKMEAMENALSALGLRLSVNIEVA

Download         Length: 429 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References