Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 699959..700641 | Replicon | plasmid pCB3060_1 |
Accession | NZ_CP104159 | ||
Organism | Rhizobium tropici strain CB3060 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N2601_RS22655 | Protein ID | WP_104826581.1 |
Coordinates | 699959..700381 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N2601_RS22660 | Protein ID | WP_104826582.1 |
Coordinates | 700378..700641 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2601_RS22645 (N2601_22645) | 695227..697713 | + | 2487 | WP_260304997.1 | malto-oligosyltrehalose synthase | - |
N2601_RS22650 (N2601_22650) | 697803..699878 | + | 2076 | WP_260304998.1 | glycogen debranching protein GlgX | - |
N2601_RS22655 (N2601_22655) | 699959..700381 | - | 423 | WP_104826581.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N2601_RS22660 (N2601_22660) | 700378..700641 | - | 264 | WP_104826582.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
N2601_RS22665 (N2601_22665) | 700754..701755 | - | 1002 | WP_260304999.1 | YihY/virulence factor BrkB family protein | - |
N2601_RS22670 (N2601_22670) | 701965..704238 | - | 2274 | WP_260305000.1 | cation:proton antiporter | - |
N2601_RS22675 (N2601_22675) | 704838..705554 | + | 717 | WP_104826585.1 | GntR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | katA / icl | 1..2260376 | 2260376 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15592.90 Da Isoelectric Point: 5.2291
>T257355 WP_104826581.1 NZ_CP104159:c700381-699959 [Rhizobium tropici]
VRLLLDTNVLSEVTRPRPDAHVLKWLDGLDEDRSFISVVSIAEIRRGVALMDSGRKRDALTEWLAQDLPQRFEHRVLPVN
EPVAVAWGDLMGLAKRNGRGLSSMDGLIAATAIAHDLTLATRNIRDFEGFGIELVDPWVV
VRLLLDTNVLSEVTRPRPDAHVLKWLDGLDEDRSFISVVSIAEIRRGVALMDSGRKRDALTEWLAQDLPQRFEHRVLPVN
EPVAVAWGDLMGLAKRNGRGLSSMDGLIAATAIAHDLTLATRNIRDFEGFGIELVDPWVV
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|