Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4053504..4054147 | Replicon | chromosome |
| Accession | NZ_CP104158 | ||
| Organism | Rhizobium tropici strain CB3060 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N2601_RS19540 | Protein ID | WP_104821786.1 |
| Coordinates | 4053504..4053908 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N2601_RS19545 | Protein ID | WP_104821787.1 |
| Coordinates | 4053905..4054147 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2601_RS19505 (N2601_19505) | 4048601..4049506 | + | 906 | WP_104821779.1 | LysR family transcriptional regulator | - |
| N2601_RS19510 (N2601_19510) | 4049507..4050382 | - | 876 | WP_104821780.1 | LysR family transcriptional regulator | - |
| N2601_RS19515 (N2601_19515) | 4050479..4051762 | + | 1284 | WP_104821781.1 | MFS transporter | - |
| N2601_RS19520 (N2601_19520) | 4051785..4052171 | + | 387 | WP_104821782.1 | VOC family protein | - |
| N2601_RS19525 (N2601_19525) | 4052290..4052631 | + | 342 | WP_104821783.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| N2601_RS19530 (N2601_19530) | 4052615..4053097 | + | 483 | WP_104821784.1 | SRPBCC domain-containing protein | - |
| N2601_RS19535 (N2601_19535) | 4053103..4053507 | + | 405 | WP_104821785.1 | GFA family protein | - |
| N2601_RS19540 (N2601_19540) | 4053504..4053908 | - | 405 | WP_104821786.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N2601_RS19545 (N2601_19545) | 4053905..4054147 | - | 243 | WP_104821787.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N2601_RS19550 (N2601_19550) | 4054213..4054887 | - | 675 | WP_104821788.1 | hypothetical protein | - |
| N2601_RS19555 (N2601_19555) | 4055013..4056674 | - | 1662 | WP_104821789.1 | urocanate hydratase | - |
| N2601_RS19560 (N2601_19560) | 4056717..4057046 | - | 330 | WP_104821790.1 | TfoX/Sxy family protein | - |
| N2601_RS19565 (N2601_19565) | 4057065..4058165 | - | 1101 | WP_104821791.1 | DUF917 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15055.16 Da Isoelectric Point: 6.4885
>T257354 WP_104821786.1 NZ_CP104158:c4053908-4053504 [Rhizobium tropici]
VKYLLDSNAVIALMKGHTGFVSELRRHKPQDFAISAIVAHELFYGAYKGQRVADNLVRVDALQFETLDFDREDARVAGEI
RANLASLGTPIGAYDVLIAGQAVARDLILITRNVREFERVHKLRFEDWESLPSS
VKYLLDSNAVIALMKGHTGFVSELRRHKPQDFAISAIVAHELFYGAYKGQRVADNLVRVDALQFETLDFDREDARVAGEI
RANLASLGTPIGAYDVLIAGQAVARDLILITRNVREFERVHKLRFEDWESLPSS
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|