Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ParE-CopA/ParE-RHH |
| Location | 3856746..3857311 | Replicon | chromosome |
| Accession | NZ_CP104158 | ||
| Organism | Rhizobium tropici strain CB3060 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | N2601_RS18525 | Protein ID | WP_104821614.1 |
| Coordinates | 3857018..3857311 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | copA | Uniprot ID | - |
| Locus tag | N2601_RS18520 | Protein ID | WP_104821613.1 |
| Coordinates | 3856746..3857030 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2601_RS18500 (N2601_18500) | 3852199..3853836 | + | 1638 | WP_104821609.1 | ABC transporter ATP-binding protein | - |
| N2601_RS18505 (N2601_18505) | 3853849..3854808 | + | 960 | WP_104821610.1 | glyoxylate/hydroxypyruvate reductase A | - |
| N2601_RS18510 (N2601_18510) | 3854886..3855155 | + | 270 | WP_158704412.1 | hypothetical protein | - |
| N2601_RS18515 (N2601_18515) | 3855354..3856658 | + | 1305 | WP_104821612.1 | nicotinate phosphoribosyltransferase | - |
| N2601_RS18520 (N2601_18520) | 3856746..3857030 | + | 285 | WP_104821613.1 | CopG family transcriptional regulator | Antitoxin |
| N2601_RS18525 (N2601_18525) | 3857018..3857311 | + | 294 | WP_104821614.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N2601_RS18530 (N2601_18530) | 3857323..3858288 | - | 966 | WP_245463960.1 | hypothetical protein | - |
| N2601_RS18535 (N2601_18535) | 3858453..3860615 | + | 2163 | WP_104821615.1 | mechanosensitive ion channel family protein | - |
| N2601_RS18540 (N2601_18540) | 3860713..3861741 | + | 1029 | WP_104821616.1 | aldo/keto reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10960.65 Da Isoelectric Point: 10.5026
>T257353 WP_104821614.1 NZ_CP104158:3857018-3857311 [Rhizobium tropici]
MPSVRLTQRALRDLERMRAFLRSKNAAAARKASARIIQTIQILSSQPDMGRPVEGSEQGLRELIVTFGRDGYIVLYQYIG
EDVLIAAIRHGREDGYK
MPSVRLTQRALRDLERMRAFLRSKNAAAARKASARIIQTIQILSSQPDMGRPVEGSEQGLRELIVTFGRDGYIVLYQYIG
EDVLIAAIRHGREDGYK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|