Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/Phd-VapC |
Location | 2464058..2464722 | Replicon | chromosome |
Accession | NZ_CP104158 | ||
Organism | Rhizobium tropici strain CB3060 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N2601_RS12010 | Protein ID | WP_260303101.1 |
Coordinates | 2464058..2464312 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N2601_RS12015 | Protein ID | WP_260303102.1 |
Coordinates | 2464312..2464722 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2601_RS11980 (N2601_11980) | 2459570..2460151 | + | 582 | WP_104824045.1 | NAD(P)H-dependent oxidoreductase | - |
N2601_RS11985 (N2601_11985) | 2460195..2460584 | - | 390 | WP_104825181.1 | Rid family hydrolase | - |
N2601_RS11990 (N2601_11990) | 2460697..2461593 | - | 897 | WP_104824046.1 | DMT family transporter | - |
N2601_RS11995 (N2601_11995) | 2461793..2462230 | + | 438 | WP_260303098.1 | hypothetical protein | - |
N2601_RS12000 (N2601_12000) | 2462262..2462879 | - | 618 | WP_260303099.1 | alpha/beta hydrolase | - |
N2601_RS12005 (N2601_12005) | 2462893..2463825 | - | 933 | WP_260303100.1 | VOC family protein | - |
N2601_RS12010 (N2601_12010) | 2464058..2464312 | + | 255 | WP_260303101.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Toxin |
N2601_RS12015 (N2601_12015) | 2464312..2464722 | + | 411 | WP_260303102.1 | type II toxin-antitoxin system VapC family toxin | Antitoxin |
N2601_RS12020 (N2601_12020) | 2464716..2465417 | - | 702 | WP_260303103.1 | uracil-DNA glycosylase | - |
N2601_RS12025 (N2601_12025) | 2465507..2466121 | - | 615 | WP_260303104.1 | septation protein IspZ | - |
N2601_RS12030 (N2601_12030) | 2466236..2468683 | - | 2448 | WP_260303105.1 | FAD-dependent oxidoreductase | - |
N2601_RS12035 (N2601_12035) | 2468693..2469571 | - | 879 | WP_104824055.1 | choline kinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9200.27 Da Isoelectric Point: 4.4165
>T257350 WP_260303101.1 NZ_CP104158:2464058-2464312 [Rhizobium tropici]
MDWPLQDAKNQFSKVVQKARSEGPQTVTLRGERAAVVLSAEDYDALRAGKPSLVDDLLSGPAWDDELADAVITRDKTPSR
DVAF
MDWPLQDAKNQFSKVVQKARSEGPQTVTLRGERAAVVLSAEDYDALRAGKPSLVDDLLSGPAWDDELADAVITRDKTPSR
DVAF
Download Length: 255 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15182.37 Da Isoelectric Point: 6.4860
>AT257350 WP_260303102.1 NZ_CP104158:2464312-2464722 [Rhizobium tropici]
MYLIDTNIISEARRGTIEAISWLRIADPSTVYLSVITLGEVMRGIALKRRTDPRAAAHLEEWLRKLRHDHSGRILPITDQ
IAVEWGRISALRPRGDADGLIAATAIVHDLIIVTRNVSDFDDAGVSVINPWDQASY
MYLIDTNIISEARRGTIEAISWLRIADPSTVYLSVITLGEVMRGIALKRRTDPRAAAHLEEWLRKLRHDHSGRILPITDQ
IAVEWGRISALRPRGDADGLIAATAIVHDLIIVTRNVSDFDDAGVSVINPWDQASY
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|