Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 721167..721726 | Replicon | chromosome |
Accession | NZ_CP104158 | ||
Organism | Rhizobium tropici strain CB3060 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N2601_RS03560 | Protein ID | WP_104822466.1 |
Coordinates | 721167..721532 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N2601_RS03565 | Protein ID | WP_104822467.1 |
Coordinates | 721529..721726 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2601_RS03540 (N2601_03540) | 716203..717447 | - | 1245 | WP_104822464.1 | efflux RND transporter periplasmic adaptor subunit | - |
N2601_RS03545 (N2601_03545) | 717879..718668 | - | 790 | Protein_702 | SDR family oxidoreductase | - |
N2601_RS03550 (N2601_03550) | 718954..720618 | + | 1665 | WP_104822465.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
N2601_RS03555 (N2601_03555) | 720624..721151 | + | 528 | WP_104825033.1 | GNAT family N-acetyltransferase | - |
N2601_RS03560 (N2601_03560) | 721167..721532 | - | 366 | WP_104822466.1 | PIN domain-containing protein | Toxin |
N2601_RS03565 (N2601_03565) | 721529..721726 | - | 198 | WP_104822467.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N2601_RS03570 (N2601_03570) | 721829..722731 | - | 903 | WP_104822468.1 | DMT family transporter | - |
N2601_RS03575 (N2601_03575) | 722877..723350 | + | 474 | WP_104822469.1 | Lrp/AsnC family transcriptional regulator | - |
N2601_RS03580 (N2601_03580) | 723401..724774 | - | 1374 | WP_104822470.1 | magnesium transporter | - |
N2601_RS03585 (N2601_03585) | 724973..725161 | - | 189 | WP_158704428.1 | hypothetical protein | - |
N2601_RS03590 (N2601_03590) | 725172..726380 | - | 1209 | WP_245463969.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13818.11 Da Isoelectric Point: 8.4792
>T257348 WP_104822466.1 NZ_CP104158:c721532-721167 [Rhizobium tropici]
MILVDTSIWIDHFHSLDAKLQSLLEQKQVLIHPFVIGEISLGNLRQYDLVMRSLSRLYQISKAPDDDVLYFIRSNRLQGM
GIGYVDAHLAAAAILTPGTYLWTRDKRLQRVAENLRIAALL
MILVDTSIWIDHFHSLDAKLQSLLEQKQVLIHPFVIGEISLGNLRQYDLVMRSLSRLYQISKAPDDDVLYFIRSNRLQGM
GIGYVDAHLAAAAILTPGTYLWTRDKRLQRVAENLRIAALL
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|