Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-Xre |
| Location | 503427..504304 | Replicon | plasmid pSU277_1 |
| Accession | NZ_CP104148 | ||
| Organism | Sinorhizobium medicae strain SU277 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | N2598_RS20340 | Protein ID | WP_102046384.1 |
| Coordinates | 503852..504304 (+) | Length | 151 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A6G1WRV9 |
| Locus tag | N2598_RS20335 | Protein ID | WP_018012058.1 |
| Coordinates | 503427..503798 (+) | Length | 124 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2598_RS20315 (N2598_20315) | 499316..499699 | + | 384 | WP_018012062.1 | RidA family protein | - |
| N2598_RS20320 (N2598_20320) | 499716..501704 | + | 1989 | WP_024312177.1 | acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha | - |
| N2598_RS20325 (N2598_20325) | 501701..502570 | + | 870 | WP_127625757.1 | hydroxymethylglutaryl-CoA lyase | - |
| N2598_RS20330 (N2598_20330) | 502567..503352 | + | 786 | WP_024312179.1 | crotonase/enoyl-CoA hydratase family protein | - |
| N2598_RS20335 (N2598_20335) | 503427..503798 | + | 372 | WP_018012058.1 | DUF2384 domain-containing protein | Antitoxin |
| N2598_RS20340 (N2598_20340) | 503852..504304 | + | 453 | WP_102046384.1 | RES domain-containing protein | Toxin |
| N2598_RS20345 (N2598_20345) | 504429..505799 | - | 1371 | WP_024325271.1 | FAD-binding oxidoreductase | - |
| N2598_RS20350 (N2598_20350) | 505928..507031 | - | 1104 | WP_012061474.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| N2598_RS20355 (N2598_20355) | 507047..507913 | - | 867 | WP_024325272.1 | sulfate ABC transporter permease subunit CysW | - |
| N2598_RS20360 (N2598_20360) | 507903..508769 | - | 867 | WP_018209856.1 | sulfate ABC transporter permease subunit CysT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..1534656 | 1534656 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 151 a.a. Molecular weight: 16566.89 Da Isoelectric Point: 5.5883
>T257344 WP_102046384.1 NZ_CP104148:503852-504304 [Sinorhizobium medicae]
MPLSGAGAARFGGRWNPVGVPALYAARELSTAWAEYNQGFVQHPALIVQLELRDAVLADLTDFKVLADLDVDETIHSCEW
RDMLDKGAVPQTHQLRTALLARDYHGVIYPSFMSPGGTCVALWRWNGAKEPRLDVIDPEGRLPKSPASWV
MPLSGAGAARFGGRWNPVGVPALYAARELSTAWAEYNQGFVQHPALIVQLELRDAVLADLTDFKVLADLDVDETIHSCEW
RDMLDKGAVPQTHQLRTALLARDYHGVIYPSFMSPGGTCVALWRWNGAKEPRLDVIDPEGRLPKSPASWV
Download Length: 453 bp
Antitoxin
Download Length: 124 a.a. Molecular weight: 13189.32 Da Isoelectric Point: 10.0414
>AT257344 WP_018012058.1 NZ_CP104148:503427-503798 [Sinorhizobium medicae]
MMAVEFQIAAARFGDEHSPFLSARLVADRLGVTLAELSKLIGVARNTLTAKSGARKVDSALSRVVRILAMASEMAGDETR
AVIWFKHQPIPGWAGKTAFDLVGEGKADKVLAYLESVRAGVYA
MMAVEFQIAAARFGDEHSPFLSARLVADRLGVTLAELSKLIGVARNTLTAKSGARKVDSALSRVVRILAMASEMAGDETR
AVIWFKHQPIPGWAGKTAFDLVGEGKADKVLAYLESVRAGVYA
Download Length: 372 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|