Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2284630..2285273 | Replicon | plasmid pWSM1592_1 |
Accession | NZ_CP104144 | ||
Organism | Rhizobium sullae strain WSM1592 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N2599_RS31765 | Protein ID | WP_027509125.1 |
Coordinates | 2284887..2285273 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2N0DGB0 |
Locus tag | N2599_RS31760 | Protein ID | WP_027509126.1 |
Coordinates | 2284630..2284887 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2599_RS31740 (N2599_31740) | 2280303..2281184 | - | 882 | WP_027509131.1 | carbohydrate ABC transporter permease | - |
N2599_RS31745 (N2599_31745) | 2281195..2282124 | - | 930 | WP_027509130.1 | sugar ABC transporter permease | - |
N2599_RS31750 (N2599_31750) | 2282121..2283236 | - | 1116 | WP_027509129.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
N2599_RS31755 (N2599_31755) | 2283267..2283977 | - | 711 | WP_037141473.1 | GntR family transcriptional regulator | - |
N2599_RS31760 (N2599_31760) | 2284630..2284887 | + | 258 | WP_027509126.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N2599_RS31765 (N2599_31765) | 2284887..2285273 | + | 387 | WP_027509125.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N2599_RS31770 (N2599_31770) | 2285270..2285535 | + | 266 | Protein_2241 | integrase | - |
N2599_RS31775 (N2599_31775) | 2285553..2285819 | + | 267 | WP_260308594.1 | DUF2218 domain-containing protein | - |
N2599_RS31780 (N2599_31780) | 2286099..2287775 | - | 1677 | WP_027509123.1 | iron ABC transporter permease | - |
N2599_RS31785 (N2599_31785) | 2287819..2288814 | - | 996 | WP_245209221.1 | Fe(3+) ABC transporter substrate-binding protein | - |
N2599_RS31790 (N2599_31790) | 2288933..2290024 | - | 1092 | WP_084606421.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB | 1..2759627 | 2759627 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13925.10 Da Isoelectric Point: 4.5849
>T257341 WP_027509125.1 NZ_CP104144:2284887-2285273 [Rhizobium sullae]
MVIDTSAIVAVLRSEPEAAALERKVVANPIRLVPATCVLEARMVLVSRRGEHALAEIDLWLARIEADIVPVDADLVDLAT
QAWLAYGKGRHPAGLNFPDCFSYALAKRADEPLLFIGKDFSQTDIEAA
MVIDTSAIVAVLRSEPEAAALERKVVANPIRLVPATCVLEARMVLVSRRGEHALAEIDLWLARIEADIVPVDADLVDLAT
QAWLAYGKGRHPAGLNFPDCFSYALAKRADEPLLFIGKDFSQTDIEAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|