Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
Location | 2127670..2128343 | Replicon | plasmid pWSM1592_1 |
Accession | NZ_CP104144 | ||
Organism | Rhizobium sullae strain WSM1592 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N2599_RS30930 | Protein ID | WP_027512588.1 |
Coordinates | 2127939..2128343 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2N0D874 |
Locus tag | N2599_RS30925 | Protein ID | WP_027512589.1 |
Coordinates | 2127670..2127942 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2599_RS30885 (N2599_30885) | 2122790..2124384 | - | 1595 | Protein_2064 | gamma-glutamyltransferase | - |
N2599_RS30890 (N2599_30890) | 2124420..2124716 | - | 297 | Protein_2065 | ABC transporter permease subunit | - |
N2599_RS30895 (N2599_30895) | 2124905..2125246 | + | 342 | WP_244564664.1 | hypothetical protein | - |
N2599_RS30900 (N2599_30900) | 2125618..2126049 | + | 432 | WP_027512593.1 | YeeE/YedE thiosulfate transporter family protein | - |
N2599_RS30905 (N2599_30905) | 2126046..2126486 | + | 441 | WP_027512592.1 | transporter | - |
N2599_RS30910 (N2599_30910) | 2126498..2126647 | + | 150 | Protein_2069 | integrase | - |
N2599_RS30915 (N2599_30915) | 2126670..2126996 | - | 327 | WP_027512591.1 | helix-turn-helix transcriptional regulator | - |
N2599_RS30920 (N2599_30920) | 2126989..2127354 | - | 366 | WP_027512590.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N2599_RS30925 (N2599_30925) | 2127670..2127942 | + | 273 | WP_027512589.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N2599_RS30930 (N2599_30930) | 2127939..2128343 | + | 405 | WP_027512588.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N2599_RS30935 (N2599_30935) | 2128544..2128989 | + | 446 | Protein_2074 | recombinase family protein | - |
N2599_RS30940 (N2599_30940) | 2129018..2131135 | - | 2118 | WP_027512586.1 | carboxy terminal-processing peptidase | - |
N2599_RS30945 (N2599_30945) | 2131553..2132347 | + | 795 | WP_027512584.1 | exodeoxyribonuclease III | - |
N2599_RS30950 (N2599_30950) | 2132701..2133047 | + | 347 | Protein_2077 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB | 1..2759627 | 2759627 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14715.22 Da Isoelectric Point: 5.2351
>T257340 WP_027512588.1 NZ_CP104144:2127939-2128343 [Rhizobium sullae]
MNGYLLDTKIISDIIRNPFGPAARRIEEIDPKEICTSIIVAAELRYGCAKKGSAKLLAKVESVLETLPILPMDIPADIKY
GAIRAELEAAGQTLGLNDLLIAAHACALDLTLVTDNTREFQRIRGLTLENWIVR
MNGYLLDTKIISDIIRNPFGPAARRIEEIDPKEICTSIIVAAELRYGCAKKGSAKLLAKVESVLETLPILPMDIPADIKY
GAIRAELEAAGQTLGLNDLLIAAHACALDLTLVTDNTREFQRIRGLTLENWIVR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|