Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 2092600..2093192 Replicon plasmid pWSM1592_1
Accession NZ_CP104144
Organism Rhizobium sullae strain WSM1592

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag N2599_RS30700 Protein ID WP_027512628.1
Coordinates 2092600..2092893 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag N2599_RS30705 Protein ID WP_027512627.1
Coordinates 2092893..2093192 (-) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2599_RS30670 (N2599_30670) 2087632..2089998 - 2367 WP_027512633.1 VirB4 family type IV secretion system protein -
N2599_RS30675 (N2599_30675) 2089991..2090329 - 339 WP_027512632.1 type IV secretion system protein VirB3 -
N2599_RS30680 (N2599_30680) 2090335..2090634 - 300 WP_027512631.1 TrbC/VirB2 family protein -
N2599_RS30685 (N2599_30685) 2090631..2091293 - 663 WP_027512630.1 transglycosylase SLT domain-containing protein -
N2599_RS30690 (N2599_30690) 2091297..2091818 - 522 WP_084606603.1 hypothetical protein -
N2599_RS30695 (N2599_30695) 2091911..2092264 + 354 WP_027512629.1 MarR family transcriptional regulator -
N2599_RS30700 (N2599_30700) 2092600..2092893 - 294 WP_027512628.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
N2599_RS30705 (N2599_30705) 2092893..2093192 - 300 WP_027512627.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
N2599_RS30710 (N2599_30710) 2093421..2093777 - 357 WP_027512626.1 extradiol dioxygenase -
N2599_RS30715 (N2599_30715) 2094348..2094638 + 291 WP_027512625.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
N2599_RS30720 (N2599_30720) 2094635..2095012 + 378 WP_027512624.1 type II toxin-antitoxin system VapC family toxin -
N2599_RS30725 (N2599_30725) 2095025..2095273 + 249 WP_027512623.1 hypothetical protein -
N2599_RS30730 (N2599_30730) 2095270..2096400 + 1131 WP_027512622.1 tyrosine-type recombinase/integrase -
N2599_RS30735 (N2599_30735) 2096633..2096872 - 240 Protein_2034 replication initiation protein RepC -
N2599_RS30740 (N2599_30740) 2096914..2097387 - 474 WP_027512621.1 Lrp/AsnC family transcriptional regulator -
N2599_RS30745 (N2599_30745) 2097502..2098047 + 546 WP_027512620.1 alpha/beta hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - htpB 1..2759627 2759627


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-55)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11221.88 Da        Isoelectric Point: 6.4715

>T257339 WP_027512628.1 NZ_CP104144:c2092893-2092600 [Rhizobium sullae]
MRLVWTQYSLDDRDNIFSYIEAANPRAAVHVDEEIVRTARRLLEFPESGRPGRVAGTRELVIPRTPYIAAYVAMDDKIRI
LRILHGAQMWPAEIEDK

Download         Length: 294 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 10831.11 Da        Isoelectric Point: 4.8668

>AT257339 WP_027512627.1 NZ_CP104144:c2093192-2092893 [Rhizobium sullae]
MASNALVQTRIDAAVKERATAVLENMGLTVSDAVRILLTRTANEGALPLELVSNSDVHDAWFRARVLQALEDTRADVEDA
DADRHFSARRSAALRKADE

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References