Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1996309..1996889 Replicon plasmid pWSM1592_1
Accession NZ_CP104144
Organism Rhizobium sullae strain WSM1592

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N2599_RS30215 Protein ID WP_027513969.1
Coordinates 1996506..1996889 (+) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A2N0DCN4
Locus tag N2599_RS30210 Protein ID WP_027513968.1
Coordinates 1996309..1996509 (+) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2599_RS30160 (N2599_30160) 1991721..1992023 + 303 WP_156915260.1 hypothetical protein -
N2599_RS30165 (N2599_30165) 1992154..1992432 + 279 WP_245209234.1 type II toxin-antitoxin system VapB family antitoxin -
N2599_RS30170 (N2599_30170) 1992795..1993061 + 267 WP_027509766.1 type II toxin-antitoxin system ParD family antitoxin -
N2599_RS30175 (N2599_30175) 1993065..1993229 + 165 WP_156915259.1 type II toxin-antitoxin system RelE/ParE family toxin -
N2599_RS30180 (N2599_30180) 1993223..1993330 + 108 Protein_1923 methionine ABC transporter ATP-binding protein -
N2599_RS30185 (N2599_30185) 1993338..1993862 + 525 Protein_1924 MBL fold metallo-hydrolase -
N2599_RS30190 (N2599_30190) 1993853..1994200 + 348 WP_100770458.1 sulfite-sensing transcriptional repressor BigR -
N2599_RS30195 (N2599_30195) 1994197..1994607 + 411 WP_027513909.1 YeeE/YedE family protein -
N2599_RS30200 (N2599_30200) 1994604..1995034 + 431 Protein_1927 YeeE/YedE family protein -
N2599_RS30205 (N2599_30205) 1995314..1995826 - 513 WP_198521567.1 cytochrome b -
N2599_RS30210 (N2599_30210) 1996309..1996509 + 201 WP_027513968.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N2599_RS30215 (N2599_30215) 1996506..1996889 + 384 WP_027513969.1 type II toxin-antitoxin system VapC family toxin Toxin
N2599_RS30220 (N2599_30220) 1997156..1998370 - 1215 WP_051336871.1 phosphotransferase -
N2599_RS30225 (N2599_30225) 1998882..1999166 + 285 WP_027513971.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - htpB 1..2759627 2759627


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-113)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13985.15 Da        Isoelectric Point: 6.8442

>T257338 WP_027513969.1 NZ_CP104144:1996506-1996889 [Rhizobium sullae]
VILADTSIWIDHFRHVDAELRRIIEDDRLLCHPAVIGELALGSLRDRGSVMAFLAAQRGAVVATHDEVMTMIDRHGIFSM
GIGYTDAHLLASVLLDQRAALWTRDKRLRGAAEKAGASLHIPVNLPN

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7122.25 Da        Isoelectric Point: 11.1107

>AT257338 WP_027513968.1 NZ_CP104144:1996309-1996509 [Rhizobium sullae]
MRSTINLDDTLMEKARSLTGTKETAALVRQALETLVRVESGKRLIALGGTMPDAEAAPRRRSPAAK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2N0DCN4

References