Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB-HicA
Location 2374482..2375077 Replicon chromosome
Accession NZ_CP104143
Organism Rhizobium sullae strain WSM1592

Toxin (Protein)


Gene name hicA Uniprot ID A0A2N0D5C6
Locus tag N2599_RS12145 Protein ID WP_027508258.1
Coordinates 2374482..2374670 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A2N0D5C4
Locus tag N2599_RS12150 Protein ID WP_027508257.1
Coordinates 2374673..2375077 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2599_RS12120 (N2599_12120) 2369489..2370823 + 1335 WP_027508263.1 guanine deaminase -
N2599_RS12125 (N2599_12125) 2370914..2371303 + 390 WP_244915044.1 transcriptional regulator -
N2599_RS12130 (N2599_12130) 2371308..2372156 - 849 WP_027508261.1 LysR family transcriptional regulator -
N2599_RS12135 (N2599_12135) 2372252..2373217 + 966 WP_027508260.1 quinone oxidoreductase -
N2599_RS12140 (N2599_12140) 2373294..2374436 + 1143 WP_027508259.1 alpha-hydroxy acid oxidase -
N2599_RS12145 (N2599_12145) 2374482..2374670 + 189 WP_027508258.1 type II toxin-antitoxin system HicA family toxin Toxin
N2599_RS12150 (N2599_12150) 2374673..2375077 + 405 WP_027508257.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N2599_RS12155 (N2599_12155) 2375074..2375820 - 747 WP_027508256.1 metallophosphoesterase family protein -
N2599_RS12160 (N2599_12160) 2375824..2376180 - 357 WP_027508255.1 hydroxyisourate hydrolase -
N2599_RS12165 (N2599_12165) 2376177..2376677 - 501 WP_027508254.1 ureidoglycolate lyase -
N2599_RS12170 (N2599_12170) 2376681..2377043 - 363 WP_027508253.1 DUF86 domain-containing protein -
N2599_RS12175 (N2599_12175) 2377040..2377333 - 294 WP_027508252.1 nucleotidyltransferase family protein -
N2599_RS12180 (N2599_12180) 2377391..2378413 - 1023 WP_027508251.1 allantoicase -
N2599_RS12185 (N2599_12185) 2378414..2378911 - 498 WP_027508250.1 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase -
N2599_RS12190 (N2599_12190) 2378911..2379834 - 924 WP_027508249.1 allantoinase PuuE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-124)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7004.20 Da        Isoelectric Point: 11.3897

>T257336 WP_027508258.1 NZ_CP104143:2374482-2374670 [Rhizobium sullae]
MKSADVIALLKKDGWFEVARKGSHMQLKHPTRSDRVTVPHPRRDVPIGTLKSIEKQSGLSLR

Download         Length: 189 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14338.10 Da        Isoelectric Point: 4.4162

>AT257336 WP_027508257.1 NZ_CP104143:2374673-2375077 [Rhizobium sullae]
MRNYIGLIHKESDSDYGVSFPDFPGVVTAGKSLDEARRMAEEALAFHVEGMAEDGEAIPEPSSLESIMADPENGDGVAIL
VSLKTPARKAIRINITLPEDVLERVDAFAAAQGLSRSGFLARAAKHEIDRGEAA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2N0D5C6

Antitoxin

Source ID Structure
AlphaFold DB A0A2N0D5C4

References