Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-PrlF
Location 1958655..1959201 Replicon chromosome
Accession NZ_CP104143
Organism Rhizobium sullae strain WSM1592

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag N2599_RS09900 Protein ID WP_037141538.1
Coordinates 1958655..1958993 (-) Length 113 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A2N0D141
Locus tag N2599_RS09905 Protein ID WP_027509279.1
Coordinates 1958980..1959201 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2599_RS09870 (N2599_09870) 1954422..1954586 + 165 WP_156915246.1 hypothetical protein -
N2599_RS09875 (N2599_09875) 1954726..1955031 + 306 WP_027509284.1 DUF1883 domain-containing protein -
N2599_RS09880 (N2599_09880) 1955050..1956366 - 1317 WP_027509283.1 replication-associated recombination protein A -
N2599_RS09885 (N2599_09885) 1956363..1957766 - 1404 WP_027509282.1 DegQ family serine endoprotease -
N2599_RS09890 (N2599_09890) 1957885..1958259 + 375 WP_027509281.1 DUF1232 domain-containing protein -
N2599_RS09895 (N2599_09895) 1958294..1958644 + 351 WP_051336510.1 lysozyme inhibitor LprI family protein -
N2599_RS09900 (N2599_09900) 1958655..1958993 - 339 WP_037141538.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
N2599_RS09905 (N2599_09905) 1958980..1959201 - 222 WP_027509279.1 type II toxin-antitoxin system PrlF family antitoxin Antitoxin
N2599_RS09910 (N2599_09910) 1959337..1961175 - 1839 WP_027509278.1 dihydroxy-acid dehydratase -
N2599_RS09915 (N2599_09915) 1961504..1962451 + 948 WP_027509277.1 protein-methionine-sulfoxide reductase catalytic subunit MsrP -
N2599_RS09920 (N2599_09920) 1962451..1963107 + 657 WP_027509276.1 protein-methionine-sulfoxide reductase heme-binding subunit MsrQ -
N2599_RS09925 (N2599_09925) 1963408..1963830 - 423 WP_027509275.1 50S ribosomal protein L17 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(5-109)

Antitoxin

PrlF antitoxin

(4-54)


Sequences

Toxin        


Download         Length: 113 a.a.        Molecular weight: 12065.92 Da        Isoelectric Point: 8.7292

>T257335 WP_037141538.1 NZ_CP104143:c1958993-1958655 [Rhizobium sullae]
MPIFKQGDIVRVPFPSTDRDTRQRRPALVVSAGQIGENAALLWVVMITSAENRPWNGDVAIPDYVASGLPAPSVVRPVKI
ATVESRHVETIGKLSDSTVGVVLTHVRALIEG

Download         Length: 339 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8090.03 Da        Isoelectric Point: 5.0053

>AT257335 WP_027509279.1 NZ_CP104143:c1959201-1958980 [Rhizobium sullae]
MIASKLTSKAQTTIPQAVRTALHLKEGDSIIYTLEANGRVTISRAPHETPLEDPFGTFSEWDSEADRRAYADL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2N0D141

References